Psyllid ID: psy9121

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLYY
cEEEEccccccccEEEEEEccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccEEEccccccccccccccccccccEEEEcccccccccccEEcccccccEEEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHccEEEcccEEEcc
cEEEEccccccccEEEEEEccEEEEEcccccHHHHHHccccccccccHHcccccccccccccccccHHHHHccccEEEccccccccccccccccccEEEEEEEcccHcccccEEEEcccccEEEEEccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHccccHccccccHccccccHHHHHHHHHHEEEEccccEEEc
mkvyslsshpnkacYILRFKEMTIMLDCglcalplmhflplpiiptakfnnlpswiprecTEAQLEGELKeccgkvfvdsapefqpplsqlvdfsevNMILISNYLSmlalpfitegtgfegvvyateptlqIGKFYLEELVQYIektpkltsashwkdishlispfsedikprsWRQLYNLQSVYASLARVQMVgydeklyy
mkvyslsshpnkACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLYY
MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLYY
***********KACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEK***
MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPII************************LKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQY**************************IKPRSWRQLYNLQSVYASLARVQMVGYDEKLYY
********HPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLYY
MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLYY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query203 2.2.26 [Sep-21-2011]
Q8K114 658 Integrator complex subuni yes N/A 0.985 0.303 0.514 2e-55
Q2KJA6 658 Integrator complex subuni yes N/A 0.985 0.303 0.514 2e-55
Q9NV88 658 Integrator complex subuni yes N/A 0.985 0.303 0.514 3e-55
Q6DFF4 658 Integrator complex subuni N/A N/A 0.985 0.303 0.5 7e-55
Q5ZKK2 658 Integrator complex subuni yes N/A 0.985 0.303 0.485 1e-50
Q4R5Z4 637 Integrator complex subuni N/A N/A 0.881 0.281 0.446 3e-44
A7SBF0 660 Integrator complex subuni N/A N/A 0.990 0.304 0.444 4e-44
Q54SH0 712 Integrator complex subuni yes N/A 0.985 0.280 0.308 5e-21
>sp|Q8K114|INT9_MOUSE Integrator complex subunit 9 OS=Mus musculus GN=Ints9 PE=2 SV=1 Back     alignment and function desciption
 Score =  215 bits (547), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 145/204 (71%), Gaps = 4/204 (1%)

Query: 1   MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPREC 60
           MK+Y LS HP   C +L+FK  TIMLDCGL     ++FLPLP++ + + +NLP W  ++ 
Sbjct: 1   MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKD- 59

Query: 61  TEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGF 120
             A L+ ELKEC G VFVDS PEF  P ++L+D S V++ILISNY  M+ALP+ITE TGF
Sbjct: 60  GNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGF 119

Query: 121 EGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHW--KDISHLI-SPFSEDIKPRSWR 177
            G VYATEPT+QIG+  +EELV +IE+ PK  SAS W  KDI  L+ SP  + ++  +WR
Sbjct: 120 TGTVYATEPTMQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWR 179

Query: 178 QLYNLQSVYASLARVQMVGYDEKL 201
           + Y +Q V ++L+++Q+VGY +K+
Sbjct: 180 RCYTMQEVNSALSKIQLVGYSQKI 203
Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.
Mus musculus (taxid: 10090)
>sp|Q2KJA6|INT9_BOVIN Integrator complex subunit 9 OS=Bos taurus GN=INTS9 PE=2 SV=1 Back     alignment and function description
>sp|Q9NV88|INT9_HUMAN Integrator complex subunit 9 OS=Homo sapiens GN=INTS9 PE=1 SV=2 Back     alignment and function description
>sp|Q6DFF4|INT9_XENLA Integrator complex subunit 9 OS=Xenopus laevis GN=ints9 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKK2|INT9_CHICK Integrator complex subunit 9 OS=Gallus gallus GN=INTS9 PE=2 SV=1 Back     alignment and function description
>sp|Q4R5Z4|INT9_MACFA Integrator complex subunit 9 OS=Macaca fascicularis GN=INTS9 PE=2 SV=1 Back     alignment and function description
>sp|A7SBF0|INT9_NEMVE Integrator complex subunit 9 homolog OS=Nematostella vectensis GN=ints9 PE=3 SV=1 Back     alignment and function description
>sp|Q54SH0|INT9_DICDI Integrator complex subunit 9 homolog OS=Dictyostelium discoideum GN=ints9 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
242025660 664 conserved hypothetical protein [Pediculu 0.990 0.302 0.569 1e-72
307189043 661 Integrator complex subunit 9 [Camponotus 0.990 0.304 0.600 2e-72
345498046 662 PREDICTED: LOW QUALITY PROTEIN: integrat 0.990 0.303 0.586 3e-70
340719906 661 PREDICTED: integrator complex subunit 9- 0.990 0.304 0.586 6e-70
322799917 675 hypothetical protein SINV_14498 [Solenop 0.970 0.291 0.592 1e-69
350408420 661 PREDICTED: integrator complex subunit 9- 0.990 0.304 0.586 1e-69
383862659 661 PREDICTED: integrator complex subunit 9- 0.990 0.304 0.576 4e-69
380023750 661 PREDICTED: integrator complex subunit 9- 0.990 0.304 0.576 5e-69
270012467 645 hypothetical protein TcasGA2_TC006621 [T 0.990 0.311 0.589 2e-67
189240387 649 PREDICTED: similar to cleavage and polya 0.990 0.309 0.589 2e-67
>gi|242025660|ref|XP_002433242.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518783|gb|EEB20504.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 115/202 (56%), Positives = 173/202 (85%), Gaps = 1/202 (0%)

Query: 1   MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPREC 60
           MK+Y LSSHPNK CY+L+++E+TIMLDCGL A  +++FLPLP++ +++ ++LP+W+PR+C
Sbjct: 1   MKLYCLSSHPNKPCYVLKWREVTIMLDCGLSAQSVLNFLPLPLVHSSRLSSLPTWMPRDC 60

Query: 61  TEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGF 120
            +++L+GEL++CCG++ +DS PEF PP ++++DFSE++++LISNYL MLALPF+TE TGF
Sbjct: 61  LDSELDGELRDCCGRILIDSPPEFSPPQTKILDFSEIDVMLISNYLCMLALPFVTEDTGF 120

Query: 121 EGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLI-SPFSEDIKPRSWRQL 179
           +GVVY TEPT+QIG+ +LEELV++IE++PK   A HWK++ HL+  P ++  KPR+WR +
Sbjct: 121 KGVVYCTEPTMQIGRLFLEELVEWIEQSPKSNVAKHWKEVLHLLPPPLNDAFKPRNWRHI 180

Query: 180 YNLQSVYASLARVQMVGYDEKL 201
           YN+Q V ++L+R+Q+VGYDEKL
Sbjct: 181 YNMQQVNSALSRIQVVGYDEKL 202

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307189043|gb|EFN73542.1| Integrator complex subunit 9 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345498046|ref|XP_003428131.1| PREDICTED: LOW QUALITY PROTEIN: integrator complex subunit 9-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340719906|ref|XP_003398385.1| PREDICTED: integrator complex subunit 9-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322799917|gb|EFZ21058.1| hypothetical protein SINV_14498 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350408420|ref|XP_003488398.1| PREDICTED: integrator complex subunit 9-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383862659|ref|XP_003706801.1| PREDICTED: integrator complex subunit 9-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380023750|ref|XP_003695675.1| PREDICTED: integrator complex subunit 9-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|270012467|gb|EFA08915.1| hypothetical protein TcasGA2_TC006621 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240387|ref|XP_001807249.1| PREDICTED: similar to cleavage and polyadenylation specificity factor [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
FB|FBgn0036570 654 IntS9 "Integrator 9" [Drosophi 0.990 0.307 0.554 6.4e-60
MGI|MGI:1098533 658 Ints9 "integrator complex subu 0.985 0.303 0.514 4.9e-53
UNIPROTKB|F1MMA6 658 INTS9 "Integrator complex subu 0.985 0.303 0.514 6.3e-53
UNIPROTKB|Q2KJA6 658 INTS9 "Integrator complex subu 0.985 0.303 0.514 6.3e-53
UNIPROTKB|F6XI08 658 INTS9 "Uncharacterized protein 0.985 0.303 0.514 6.3e-53
UNIPROTKB|E5RG70300 INTS9 "Integrator complex subu 0.985 0.666 0.514 6.3e-53
UNIPROTKB|G3XAN1 525 INTS9 "Integrator complex subu 0.985 0.380 0.514 6.3e-53
UNIPROTKB|Q9NV88 658 INTS9 "Integrator complex subu 0.985 0.303 0.514 6.3e-53
RGD|1311539 659 Ints9 "integrator complex subu 0.985 0.303 0.5 5.6e-52
ZFIN|ZDB-GENE-061013-129 658 ints9 "integrator complex subu 0.985 0.303 0.5 2.4e-51
FB|FBgn0036570 IntS9 "Integrator 9" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 614 (221.2 bits), Expect = 6.4e-60, P = 6.4e-60
 Identities = 112/202 (55%), Positives = 156/202 (77%)

Query:     1 MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPREC 60
             M++Y LS    K CYI+ FK + IMLDCGL    +++FLPLP + + K++NLP+++P   
Sbjct:     1 MRLYCLSGDLAKPCYIITFKGLRIMLDCGLTEQTVLNFLPLPFVQSLKWSNLPNFVPSRD 60

Query:    61 TEAQLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGF 120
              + Q++GELK+CCG+VFVDS PEF  P+ +++DFSEV++ILISNYL+MLALP+ITE TGF
Sbjct:    61 HDPQMDGELKDCCGRVFVDSTPEFNLPMDKMLDFSEVDVILISNYLNMLALPYITENTGF 120

Query:   121 EGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLI-SPFSEDIKPRSWRQL 179
             +G VYATEPTLQIG+F+LEELV YIE +PK  +A  WK+  HL+ SP SE  + + WR +
Sbjct:   121 KGKVYATEPTLQIGRFFLEELVDYIEVSPKACTARLWKEKLHLLPSPLSEAFRAKKWRTI 180

Query:   180 YNLQSVYASLARVQMVGYDEKL 201
             ++L+ V  SL++V ++GYDEKL
Sbjct:   181 FSLKDVQGSLSKVTIMGYDEKL 202
GO:0005847 "mRNA cleavage and polyadenylation specificity factor complex" evidence=ISS
GO:0006379 "mRNA cleavage" evidence=ISS
GO:0006378 "mRNA polyadenylation" evidence=ISS
GO:0034472 "snRNA 3'-end processing" evidence=IDA
GO:0032039 "integrator complex" evidence=ISS
GO:0016180 "snRNA processing" evidence=ISS
MGI|MGI:1098533 Ints9 "integrator complex subunit 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMA6 INTS9 "Integrator complex subunit 9" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJA6 INTS9 "Integrator complex subunit 9" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6XI08 INTS9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E5RG70 INTS9 "Integrator complex subunit 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3XAN1 INTS9 "Integrator complex subunit 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NV88 INTS9 "Integrator complex subunit 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311539 Ints9 "integrator complex subunit 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061013-129 ints9 "integrator complex subunit 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NV88INT9_HUMANNo assigned EC number0.51470.98520.3039yesN/A
Q8K114INT9_MOUSENo assigned EC number0.51470.98520.3039yesN/A
Q2KJA6INT9_BOVINNo assigned EC number0.51470.98520.3039yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 203
KOG1138|consensus 653 100.0
KOG1136|consensus 501 99.96
COG1782 637 Predicted metal-dependent RNase, consists of a met 99.96
KOG1137|consensus 668 99.93
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.92
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 99.89
KOG1135|consensus 764 99.87
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 99.41
PRK00055 270 ribonuclease Z; Reviewed 99.36
PRK11244250 phnP carbon-phosphorus lyase complex accessory pro 99.29
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 99.23
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 99.2
PRK02113252 putative hydrolase; Provisional 99.15
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 99.12
PRK05184 302 pyrroloquinoline quinone biosynthesis protein PqqB 99.11
COG1234 292 ElaC Metal-dependent hydrolases of the beta-lactam 98.95
COG1237259 Metal-dependent hydrolases of the beta-lactamase s 98.93
TIGR03307238 PhnP phosphonate metabolism protein PhnP. This fam 98.89
PRK00685228 metal-dependent hydrolase; Provisional 98.88
PRK04286 298 hypothetical protein; Provisional 98.82
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 98.8
TIGR02108 302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 98.78
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 98.62
COG1235269 PhnP Metal-dependent hydrolases of the beta-lactam 98.48
PRK02126 334 ribonuclease Z; Provisional 98.4
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 98.3
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 98.23
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 98.13
TIGR00361662 ComEC_Rec2 DNA internalization-related competence 97.86
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 97.75
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 97.74
PRK11539755 ComEC family competence protein; Provisional 97.69
TIGR03413248 GSH_gloB hydroxyacylglutathione hydrolase. Members 97.66
PRK10241251 hydroxyacylglutathione hydrolase; Provisional 97.64
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 97.52
KOG2121|consensus 746 97.41
PLN02469 258 hydroxyacylglutathione hydrolase 97.36
COG0491252 GloB Zn-dependent hydrolases, including glyoxylase 97.35
COG2220258 Predicted Zn-dependent hydrolases of the beta-lact 97.34
COG2248304 Predicted hydrolase (metallo-beta-lactamase superf 97.13
COG2333293 ComEC Predicted hydrolase (metallo-beta-lactamase 96.92
PLN02398 329 hydroxyacylglutathione hydrolase 96.6
TIGR02650 277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 96.2
PLN02962251 hydroxyacylglutathione hydrolase 95.91
PF1369163 Lactamase_B_4: tRNase Z endonuclease 95.25
PF02112 335 PDEase_II: cAMP phosphodiesterases class-II; Inter 94.19
KOG0813|consensus 265 92.92
KOG1137|consensus 668 85.25
KOG3592|consensus 934 80.58
>KOG1138|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.1e-49  Score=361.31  Aligned_cols=203  Identities=46%  Similarity=0.796  Sum_probs=195.6

Q ss_pred             CEEEEecCCCCCCeEEEEeCCeEEEEeCCCCCccccccCCCCccCCcccCCCCCCCcccchhhhhhhhhhhhcCcccccC
Q psy9121           1 MKVYSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDS   80 (203)
Q Consensus         1 Mkl~~LG~~~~~sc~ll~~~~~~ILlDCGl~~~~~~~f~p~~~~~s~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~vds   80 (203)
                      |++|++....+-+|.++++...+||+|||+++++.+.|||+|.+||+|.+++|+|.+..+++.+++.++|+++|||||||
T Consensus         1 M~~t~~sv~~t~pc~llk~~~~rIllDcpld~t~~~nFlPlp~~qSpr~~n~p~~~~~~d~~kfq~~elke~~~rvfves   80 (653)
T KOG1138|consen    1 MEGTIGSVSSTYPCKLLKLQRRRILLDCPLDLTAILNFLPLPGVQSPRYSNLPSLDAQNDIQKFQDLELKECCGRVFVES   80 (653)
T ss_pred             CceEEEeeccCCCchheeccceeEEecCCcchhhhhccccCccccCcccccCccccccCccchhhhHHHHHhCCceEEcC
Confidence            89999999999999999999999999999999999999999999999999999999888999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCccEEEEcCCCCccchHHHHhhcCCCCcEEecchhHHHHHhhHHHHHHHHhhccccccccchhhh
Q psy9121          81 APEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDI  160 (203)
Q Consensus        81 ~~~~~~p~~~~~d~~~IDaVlISH~Hh~g~LP~l~~~~~f~g~IYaT~pT~~l~~lll~d~~~~~~~~~~~~~~~~~~~~  160 (203)
                      +|+|++|..+.+|.++||+|||||+|.+.||||+|++.||.|+||||+||+|+||++|||++.+++|.+++.++..||+.
T Consensus        81 ppe~~l~~t~lld~stiDvILISNy~~mlgLPfiTentGF~gkiY~TE~t~qiGrllMEelv~fier~p~~~S~~~Wk~k  160 (653)
T KOG1138|consen   81 PPEFTLPATHLLDASTIDVILISNYMGMLGLPFITENTGFFGKIYATEPTAQIGRLLMEELVSFIERFPKASSAPLWKKK  160 (653)
T ss_pred             CchhccchhhhhcccceeEEEEcchhhhcccceeecCCCceeEEEEechHHHHHHHHHHHHHHHHHhccccccchhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999955


Q ss_pred             --cccc-CCCccCCCCCcCCCCCCHHHHHHHHhcceeecCCcEEeC
Q psy9121         161 --SHLI-SPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLYY  203 (203)
Q Consensus       161 --~~~l-~~~~~~~~~~~~~~lYt~~Dv~~~l~~i~~v~Y~e~i~~  203 (203)
                        .+.+ +|+++..+...|+++||.+||+.|++||++|.|+|+|++
T Consensus       161 ~~~~~lpsplk~~~~~~~Wr~~ysl~Dv~sclsKVq~v~f~ekidl  206 (653)
T KOG1138|consen  161 LDSELLPSPLKKAVFLGSWRRLYSLDDVESCLSKVQGVGFAEKIDL  206 (653)
T ss_pred             hhhhhcCCCchhhccccceeeeeehhHHHHHHHhheecccceeeec
Confidence              5555 688988899999999999999999999999999999985

>KOG1136|consensus Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1135|consensus Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>KOG2121|consensus Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PF13691 Lactamase_B_4: tRNase Z endonuclease Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>KOG0813|consensus Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>KOG3592|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 4e-09
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 7e-05
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 1e-04
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Length = 717 Back     alignment and structure
 Score = 54.8 bits (131), Expect = 4e-09
 Identities = 22/204 (10%), Positives = 52/204 (25%), Gaps = 76/204 (37%)

Query: 4   YSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEA 63
                       ++RF  +T+++D G       +                          
Sbjct: 7   CCDDGSGTTVGSVVRFDNVTLLIDPG------WNP------------------------- 35

Query: 64  QLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNY----LSMLALPFITEGT- 118
                      KV  +   ++           E+++I++S      L   +L +    + 
Sbjct: 36  ----------SKVSYEQCIKYWEK-----VIPEIDVIILSQPTIECLGAHSLLYYNFTSH 80

Query: 119 -GFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWR 177
                 VYAT P + +G+    +                           S  +      
Sbjct: 81  FISRIQVYATLPVINLGRVSTIDSYA------------------------SAGVIGPYDT 116

Query: 178 QLYNLQSVYASLARVQMVGYDEKL 201
              +L+ +  S   +  + Y + +
Sbjct: 117 NKLDLEDIEISFDHIVPLKYSQLV 140
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Length = 459 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Length = 651 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.87
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 99.85
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.78
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 99.77
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.76
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 99.76
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.47
2az4_A 429 Hypothetical protein EF2904; structural genomics, 99.45
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 99.45
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.37
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 99.33
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.33
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, 99.23
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 99.18
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.14
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 99.1
3kl7_A235 Putative metal-dependent hydrolase; structural gen 99.0
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 98.98
3m8t_A294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 98.94
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 98.93
1ztc_A221 Hypothetical protein TM0894; structural genomics, 98.93
3rpc_A264 Possible metal-dependent hydrolase; structural gen 98.89
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 98.88
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 98.87
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 98.85
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 98.84
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 98.83
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, a 98.82
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 98.81
4ax1_B303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 98.8
3esh_A280 Protein similar to metal-dependent hydrolase; stru 98.79
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 98.78
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 98.77
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 98.77
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 98.75
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 98.69
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 98.69
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 98.65
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 98.64
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 98.61
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 98.57
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 98.57
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 98.56
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 98.55
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 98.53
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 98.51
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 98.49
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein 98.48
2qed_A258 Hydroxyacylglutathione hydrolase; metallo-B- super 98.47
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 98.43
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 98.42
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 98.42
4efz_A 298 Metallo-beta-lactamase family protein; structural 98.38
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 98.36
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 98.35
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 98.34
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 98.33
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase s 98.31
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 98.28
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 98.27
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 98.25
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 98.24
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 98.23
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethyl 98.2
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 98.09
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 98.0
3r2u_A 466 Metallo-beta-lactamase family protein; structural 97.98
2p97_A201 Hypothetical protein; putative metal-dependent hyd 97.95
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 97.93
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 97.82
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 96.6
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
Probab=99.87  E-value=6.8e-22  Score=179.73  Aligned_cols=124  Identities=21%  Similarity=0.315  Sum_probs=103.5

Q ss_pred             CEEEEecCC--CCCCeEEEEeCCeEEEEeCCCCCccccccCCCCccCCcccCCCCCCCcccchhhhhhhhhhhhcCcccc
Q psy9121           1 MKVYSLSSH--PNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFV   78 (203)
Q Consensus         1 Mkl~~LG~~--~~~sc~ll~~~~~~ILlDCGl~~~~~~~f~p~~~~~s~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~v   78 (203)
                      |+|++||++  +++|||+|+.++.+||+|||+......               .+.                        
T Consensus         1 M~i~~LG~~~~vg~s~~li~~~~~~iLID~G~~~~~~~---------------~~~------------------------   41 (431)
T 3iek_A            1 MRIVPFGAAREVTGSAHLLLAGGRRVLLDCGMFQGKEE---------------ARN------------------------   41 (431)
T ss_dssp             CEEEECSCSSSSSCCCEEEEETTEEEEECCCCCCGGGG---------------GGG------------------------
T ss_pred             CEEEEeCCCCCCCCcEEEEEECCeEEEEeCCCCcchhh---------------ccc------------------------
Confidence            999999986  999999999999999999998543100               000                        


Q ss_pred             cCCCCCCCCCCCCCCCCCccEEEEcCCC--CccchHHHHhhcCCCCcEEecchhHHHHHhhHHHHHHHHhhccccccccc
Q psy9121          79 DSAPEFQPPLSQLVDFSEVNMILISNYL--SMLALPFITEGTGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASH  156 (203)
Q Consensus        79 ds~~~~~~p~~~~~d~~~IDaVlISH~H--h~g~LP~l~~~~~f~g~IYaT~pT~~l~~lll~d~~~~~~~~~~~~~~~~  156 (203)
                             .+. ..+++.+||+|||||+|  |+|+||++.+ .+|+++||||++|.++.+.+++|..++.           
T Consensus        42 -------~~~-~~~~~~~Id~VllTH~H~DH~gglp~l~~-~~~~~~Iy~t~~t~~l~~~~l~d~~~~~-----------  101 (431)
T 3iek_A           42 -------HAP-FGFDPKEVDAVLLTHAHLDHVGRLPKLFR-EGYRGPVYATRATVLLMEIVLEDALKVM-----------  101 (431)
T ss_dssp             -------GSC-CSSCGGGCCEEECSCCCHHHHTTHHHHHH-TTCCSCEEECHHHHHHHHHHHHHHHHHC-----------
T ss_pred             -------hhh-cCCCcccCCEEEECCCChHHhccHHHHHH-cCCCCeEEEcHHHHHHHHHHHHHHHhhc-----------
Confidence                   000 23577899999999999  9999999997 6889999999999999999999987642           


Q ss_pred             hhhhccccCCCccCCCCCcCCCCCCHHHHHHHHhcceeecCCcEEe
Q psy9121         157 WKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLY  202 (203)
Q Consensus       157 ~~~~~~~l~~~~~~~~~~~~~~lYt~~Dv~~~l~~i~~v~Y~e~i~  202 (203)
                                         ..++|+.+|+++++++++.+.|+++++
T Consensus       102 -------------------~~~~y~~~~~~~~~~~~~~l~~~~~~~  128 (431)
T 3iek_A          102 -------------------DEPFFGPEDVEEALGHLRPLEYGEWLR  128 (431)
T ss_dssp             -------------------SSCSSCHHHHHHHHHTEEECCTTCCEE
T ss_pred             -------------------ccCCCCHHHHHHHHhccEEcCCCCeEE
Confidence                               126899999999999999999999875
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 203
d2i7xa1 514 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two 3e-09
d2i7ta1 451 d.157.1.10 (A:9-459) Cleavage and polyadenylation 4e-04
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 514 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage factor two protein 2, CFT2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 53.3 bits (127), Expect = 3e-09
 Identities = 22/204 (10%), Positives = 50/204 (24%), Gaps = 76/204 (37%)

Query: 4   YSLSSHPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEA 63
                       ++RF  +T+++D G                         W P + +  
Sbjct: 7   CCDDGSGTTVGSVVRFDNVTLLIDPG-------------------------WNPSKVSYE 41

Query: 64  QLEGELKECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLS--MLALPFI----TEG 117
           Q     ++                        E+++I++S      + A   +    T  
Sbjct: 42  QCIKYWEK---------------------VIPEIDVIILSQPTIECLGAHSLLYYNFTSH 80

Query: 118 TGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSASHWKDISHLISPFSEDIKPRSWR 177
                 VYAT P + +G+    +                                     
Sbjct: 81  FISRIQVYATLPVINLGRVSTIDSYASAGVIGP------------------------YDT 116

Query: 178 QLYNLQSVYASLARVQMVGYDEKL 201
              +L+ +  S   +  + Y + +
Sbjct: 117 NKLDLEDIEISFDHIVPLKYSQLV 140
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 451 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 99.93
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.9
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.89
d1zkpa1244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.36
d2cbna1 305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 99.35
d1y44a1 307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 99.32
d1xtoa_ 304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 99.25
d2aioa1266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.0
d1wraa1 305 Teichoic acid phosphorylcholine esterase Pce (LytD 98.95
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 98.92
d2gmna1264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 98.88
d1k07a_262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 98.74
d1p9ea_294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 98.7
d2e7ya1 280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 98.62
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 98.53
d1vmea2250 ROO-like flavoprotein TM0755, N-terminal domain {T 98.36
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 98.35
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 98.2
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 98.06
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 97.96
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 97.95
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 97.95
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 97.7
d1vjna_209 Hypothetical protein TM0207 {Thermotoga maritima [ 97.68
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 97.53
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 97.42
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 97.36
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 96.98
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 96.35
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 96.12
d2qeda1251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 95.63
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage factor two protein 2, CFT2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.93  E-value=4.4e-26  Score=209.24  Aligned_cols=131  Identities=15%  Similarity=0.139  Sum_probs=103.5

Q ss_pred             EEEEecC-CCCCCeEEEEeCCeEEEEeCCCCCccccccCCCCccCCcccCCCCCCCcccchhhhhhhhhhhhcCcccccC
Q psy9121           2 KVYSLSS-HPNKACYILRFKEMTIMLDCGLCALPLMHFLPLPIIPTAKFNNLPSWIPRECTEAQLEGELKECCGKVFVDS   80 (203)
Q Consensus         2 kl~~LG~-~~~~sc~ll~~~~~~ILlDCGl~~~~~~~f~p~~~~~s~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~vds   80 (203)
                      ++.|+|. +.+++|+||++++.+||||||++++...                         ..   +.++          
T Consensus         4 ~~~~~~~g~g~~sc~ll~~~~~~iLlDcG~~~~~~~-------------------------~~---~~~~----------   45 (514)
T d2i7xa1           4 KYNCCDDGSGTTVGSVVRFDNVTLLIDPGWNPSKVS-------------------------YE---QCIK----------   45 (514)
T ss_dssp             EEEECCSSSSSCCCEEEEETTEEEEECCCCCTTTSC-------------------------HH---HHHH----------
T ss_pred             EEEEecCCCceeeEEEEEECCeEEEEECCCCcCccc-------------------------hh---hhhh----------
Confidence            4677874 4788999999999999999999764110                         00   0011          


Q ss_pred             CCCCCCCCCCCCCCCCccEEEEcCCC--CccchHHHHhh----cCCCCcEEecchhHHHHHhhHHHHHHHHhhccccccc
Q psy9121          81 APEFQPPLSQLVDFSEVNMILISNYL--SMLALPFITEG----TGFEGVVYATEPTLQIGKFYLEELVQYIEKTPKLTSA  154 (203)
Q Consensus        81 ~~~~~~p~~~~~d~~~IDaVlISH~H--h~g~LP~l~~~----~~f~g~IYaT~pT~~l~~lll~d~~~~~~~~~~~~~~  154 (203)
                              +...++++||||||||+|  |+||||||.+.    .+|++|||||+||+++++++|+|+++......     
T Consensus        46 --------~~~~~~~~IdaillTH~H~DHiGalP~L~~~~~~~~~~~~pIy~T~~T~~l~~~~l~d~~~~~~~~~-----  112 (514)
T d2i7xa1          46 --------YWEKVIPEIDVIILSQPTIECLGAHSLLYYNFTSHFISRIQVYATLPVINLGRVSTIDSYASAGVIG-----  112 (514)
T ss_dssp             --------HHHTTGGGCCEEECCCSSHHHHTTHHHHHHHSHHHHHHTCEEEEEHHHHHHHHHHHHHHHHHTTSSS-----
T ss_pred             --------hhhcCcccCCEEEECCCChHHHCchHHHHHhcccccCCCcCEEeCHHHHHHHHHHHHHHHHHhhhhc-----
Confidence                    122457899999999999  99999999864    36789999999999999999999988654321     


Q ss_pred             cchhhhccccCCCccCCCCCcCCCCCCHHHHHHHHhcceeecCCcEEe
Q psy9121         155 SHWKDISHLISPFSEDIKPRSWRQLYNLQSVYASLARVQMVGYDEKLY  202 (203)
Q Consensus       155 ~~~~~~~~~l~~~~~~~~~~~~~~lYt~~Dv~~~l~~i~~v~Y~e~i~  202 (203)
                                         ....++|+.+||+++++++++++|+|++.
T Consensus       113 -------------------~~~~~~~~~~dv~~~~~~~~~~~y~e~~~  141 (514)
T d2i7xa1         113 -------------------PYDTNKLDLEDIEISFDHIVPLKYSQLVD  141 (514)
T ss_dssp             -------------------SBTTCCSCHHHHHHHHHTSEEECTTCCEE
T ss_pred             -------------------ccccCCCCHHHHHHHHHhcccCCCCCeEE
Confidence                               12457899999999999999999999875
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure