Diaphorina citri psyllid: psy9125


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAGLTGQPHHTSMAASQFAVQGLSEALAQQLWKKPNVHVTLVHIYPFLLSADLKSNIRLR
cCECccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccCEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccCEEEEEcccEECcccccccccc
MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAGLTGQPHHTSMAASQFAVQGLSEALAQQLWKKPNVHVTLVHIYPFLLSADLKSNIRL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAGLTGQPHHTSMAASQFAVQGLSEALAQQLWKKPNVHVTLVHIYPFLLSADLKSNIRLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0050327 [MF]testosterone 17-beta-dehydrogenase (NAD+) activityprobableGO:0016229, GO:0016614, GO:0016616, GO:0033764, GO:0003824, GO:0003674, GO:0016491
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0008202 [BP]steroid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P19, chain A
Confidence level:very confident
Coverage over the Query: 1-113
View the alignment between query and template
View the model in PyMOL