Psyllid ID: psy9125
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 117 | ||||||
| 340721990 | 344 | PREDICTED: epidermal retinol dehydrogena | 0.991 | 0.337 | 0.454 | 6e-23 | |
| 350414859 | 306 | PREDICTED: epidermal retinol dehydrogena | 0.991 | 0.379 | 0.454 | 6e-23 | |
| 383864536 | 318 | PREDICTED: epidermal retinol dehydrogena | 0.991 | 0.364 | 0.454 | 4e-22 | |
| 345498454 | 294 | PREDICTED: 17-beta-hydroxysteroid dehydr | 0.991 | 0.394 | 0.462 | 4e-22 | |
| 328791425 | 315 | PREDICTED: epidermal retinol dehydrogena | 0.991 | 0.368 | 0.429 | 1e-21 | |
| 380015946 | 306 | PREDICTED: epidermal retinol dehydrogena | 0.991 | 0.379 | 0.421 | 2e-21 | |
| 170069297 | 330 | dehydrogenase/reductase SDR family membe | 0.991 | 0.351 | 0.425 | 2e-21 | |
| 157113110 | 304 | short-chain dehydrogenase [Aedes aegypti | 0.991 | 0.381 | 0.433 | 2e-21 | |
| 307169870 | 292 | Epidermal retinal dehydrogenase 2 [Campo | 0.991 | 0.397 | 0.442 | 2e-21 | |
| 114052048 | 324 | epidermal retinal dehydrogenase [Bombyx | 0.991 | 0.358 | 0.428 | 3e-21 |
| >gi|340721990|ref|XP_003399395.1| PREDICTED: epidermal retinol dehydrogenase 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Score = 111 bits (277), Expect = 6e-23, Method: Compositional matrix adjust.
Identities = 55/121 (45%), Positives = 83/121 (68%), Gaps = 5/121 (4%)
Query: 1 MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAG 60
M+ HCC + SP ALL + +++ T +L++LSHFWLL+ L M +G+GH V LSSVAG
Sbjct: 162 MLFHCCSIPSPRALL-QDPPEIRHTIDLTILSHFWLLDTVLPCMERAGKGHIVVLSSVAG 220
Query: 61 LTGQP---HHTSMAASQFAVQGLSEALAQQLWK-KPNVHVTLVHIYPFLLSADLKSNIRL 116
L+G + S++ +QFAVQGL+E+L +L N+ +TLVH+YPF++ A++ +IR
Sbjct: 221 LSGTATGGNRVSLSTAQFAVQGLAESLHTELRHLNSNIIITLVHVYPFIVGAEIAKDIRF 280
Query: 117 R 117
R
Sbjct: 281 R 281
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350414859|ref|XP_003490446.1| PREDICTED: epidermal retinol dehydrogenase 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383864536|ref|XP_003707734.1| PREDICTED: epidermal retinol dehydrogenase 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345498454|ref|XP_001600286.2| PREDICTED: 17-beta-hydroxysteroid dehydrogenase 13-like, partial [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328791425|ref|XP_625124.2| PREDICTED: epidermal retinol dehydrogenase 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380015946|ref|XP_003691955.1| PREDICTED: epidermal retinol dehydrogenase 2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|170069297|ref|XP_001869180.1| dehydrogenase/reductase SDR family member 8 [Culex quinquefasciatus] gi|167865182|gb|EDS28565.1| dehydrogenase/reductase SDR family member 8 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|157113110|ref|XP_001651898.1| short-chain dehydrogenase [Aedes aegypti] gi|157113112|ref|XP_001651899.1| short-chain dehydrogenase [Aedes aegypti] gi|108877900|gb|EAT42125.1| AAEL006317-PB [Aedes aegypti] gi|108877901|gb|EAT42126.1| AAEL006317-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|307169870|gb|EFN62379.1| Epidermal retinal dehydrogenase 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|114052048|ref|NP_001040522.1| epidermal retinal dehydrogenase [Bombyx mori] gi|95102794|gb|ABF51338.1| epidermal retinal dehydrogenase [Bombyx mori] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 117 | ||||||
| FB|FBgn0029994 | 320 | CG2254 [Drosophila melanogaste | 1.0 | 0.365 | 0.355 | 1.2e-15 | |
| FB|FBgn0032405 | 318 | CG14946 [Drosophila melanogast | 0.940 | 0.345 | 0.315 | 6.6e-13 | |
| RGD|1562060 | 316 | Sdr16c6 "short chain dehydroge | 0.871 | 0.322 | 0.326 | 6.8e-11 | |
| ASPGD|ASPL0000047603 | 337 | AN8896 [Emericella nidulans (t | 0.854 | 0.296 | 0.320 | 1e-10 | |
| FB|FBgn0032910 | 428 | CG9265 [Drosophila melanogaste | 0.923 | 0.252 | 0.324 | 1.1e-10 | |
| UNIPROTKB|Q2KIS5 | 316 | HSD17B11 "Uncharacterized prot | 0.658 | 0.243 | 0.379 | 1.9e-10 | |
| UNIPROTKB|F1PKW3 | 305 | SPARCL1 "Uncharacterized prote | 0.581 | 0.222 | 0.411 | 2.2e-10 | |
| ZFIN|ZDB-GENE-040426-2049 | 306 | sdr16c5a "short chain dehydrog | 0.923 | 0.352 | 0.312 | 3.7e-10 | |
| UNIPROTKB|F1NUP9 | 305 | SDR16C5 "Uncharacterized prote | 0.940 | 0.360 | 0.245 | 4.8e-10 | |
| UNIPROTKB|Q7Z5P4 | 300 | HSD17B13 "17-beta-hydroxystero | 0.752 | 0.293 | 0.329 | 7.6e-10 |
| FB|FBgn0029994 CG2254 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 198 (74.8 bits), Expect = 1.2e-15, P = 1.2e-15
Identities = 42/118 (35%), Positives = 69/118 (58%)
Query: 1 MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAG 60
+V++ G+ H LL+ + +++ +E++VLSHFW+++ FL M+ G V LSS AG
Sbjct: 138 VVVNNAGIMPCHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAG 197
Query: 61 LTGQPHHTSMAASQFAVQGLSEALAQQLWKK-PNVHVTLVHIYPFLLSADLKSNIRLR 117
L G + ++FAV+G AL ++L +K P +V L IYP+++ L N R R
Sbjct: 198 LFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYR 255
|
|
| FB|FBgn0032405 CG14946 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|1562060 Sdr16c6 "short chain dehydrogenase/reductase family 16C, member 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000047603 AN8896 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032910 CG9265 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KIS5 HSD17B11 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PKW3 SPARCL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2049 sdr16c5a "short chain dehydrogenase/reductase family 16C, member 5a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NUP9 SDR16C5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z5P4 HSD17B13 "17-beta-hydroxysteroid dehydrogenase 13" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 117 | |||
| cd05339 | 243 | cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy | 2e-21 | |
| cd05233 | 234 | cd05233, SDR_c, classical (c) SDRs | 1e-16 | |
| cd05350 | 239 | cd05350, SDR_c6, classical (c) SDR, subgroup 6 | 4e-15 | |
| cd08939 | 239 | cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine | 5e-14 | |
| cd09806 | 258 | cd09806, type1_17beta-HSD-like_SDR_c, human estrog | 2e-13 | |
| cd05374 | 248 | cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster | 2e-13 | |
| COG0300 | 265 | COG0300, DltE, Short-chain dehydrogenases of vario | 3e-13 | |
| cd05332 | 257 | cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste | 5e-12 | |
| cd08932 | 223 | cd08932, HetN_like_SDR_c, HetN oxidoreductase-like | 2e-11 | |
| PRK07666 | 239 | PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) | 2e-11 | |
| PRK07832 | 272 | PRK07832, PRK07832, short chain dehydrogenase; Pro | 5e-11 | |
| COG4221 | 246 | COG4221, COG4221, Short-chain alcohol dehydrogenas | 9e-11 | |
| PRK06181 | 263 | PRK06181, PRK06181, short chain dehydrogenase; Pro | 2e-09 | |
| PRK08263 | 275 | PRK08263, PRK08263, short chain dehydrogenase; Pro | 3e-09 | |
| PRK06180 | 277 | PRK06180, PRK06180, short chain dehydrogenase; Pro | 3e-09 | |
| COG1028 | 251 | COG1028, FabG, Dehydrogenases with different speci | 5e-09 | |
| PRK05653 | 246 | PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) | 2e-08 | |
| cd05354 | 235 | cd05354, SDR_c7, classical (c) SDR, subgroup 7 | 2e-08 | |
| PRK08219 | 227 | PRK08219, PRK08219, short chain dehydrogenase; Pro | 4e-08 | |
| PRK09291 | 257 | PRK09291, PRK09291, short chain dehydrogenase; Pro | 7e-08 | |
| cd02266 | 186 | cd02266, SDR, Short-chain dehydrogenases/reductase | 8e-08 | |
| cd05341 | 247 | cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta | 1e-07 | |
| PRK07825 | 273 | PRK07825, PRK07825, short chain dehydrogenase; Pro | 2e-07 | |
| PRK12824 | 245 | PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro | 2e-07 | |
| PRK12826 | 251 | PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote | 3e-07 | |
| PRK12829 | 264 | PRK12829, PRK12829, short chain dehydrogenase; Pro | 3e-07 | |
| PRK06139 | 330 | PRK06139, PRK06139, short chain dehydrogenase; Pro | 4e-07 | |
| cd05368 | 241 | cd05368, DHRS6_like_SDR_c, human DHRS6-like, class | 4e-07 | |
| PRK12936 | 245 | PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote | 9e-07 | |
| cd05333 | 240 | cd05333, BKR_SDR_c, beta-Keto acyl carrier protein | 1e-06 | |
| PRK06172 | 253 | PRK06172, PRK06172, short chain dehydrogenase; Pro | 1e-06 | |
| PRK05557 | 248 | PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) | 1e-06 | |
| cd08933 | 261 | cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl | 1e-06 | |
| cd08934 | 243 | cd08934, CAD_SDR_c, clavulanic acid dehydrogenase | 2e-06 | |
| PRK12825 | 249 | PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) | 2e-06 | |
| cd08944 | 246 | cd08944, SDR_c12, classical (c) SDR, subgroup 12 | 2e-06 | |
| PRK07985 | 294 | PRK07985, PRK07985, oxidoreductase; Provisional | 3e-06 | |
| PRK06484 | 520 | PRK06484, PRK06484, short chain dehydrogenase; Val | 4e-06 | |
| cd05366 | 257 | cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol | 5e-06 | |
| cd05362 | 243 | cd05362, THN_reductase-like_SDR_c, tetrahydroxynap | 5e-06 | |
| PRK08017 | 256 | PRK08017, PRK08017, oxidoreductase; Provisional | 6e-06 | |
| PRK08267 | 260 | PRK08267, PRK08267, short chain dehydrogenase; Pro | 7e-06 | |
| PRK07024 | 257 | PRK07024, PRK07024, short chain dehydrogenase; Pro | 1e-05 | |
| PRK06914 | 280 | PRK06914, PRK06914, short chain dehydrogenase; Pro | 1e-05 | |
| cd05360 | 233 | cd05360, SDR_c3, classical (c) SDR, subgroup 3 | 2e-05 | |
| PRK05993 | 277 | PRK05993, PRK05993, short chain dehydrogenase; Pro | 2e-05 | |
| pfam00106 | 167 | pfam00106, adh_short, short chain dehydrogenase | 2e-05 | |
| cd05373 | 238 | cd05373, SDR_c10, classical (c) SDR, subgroup 10 | 2e-05 | |
| TIGR01830 | 239 | TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier | 3e-05 | |
| PRK06179 | 270 | PRK06179, PRK06179, short chain dehydrogenase; Pro | 3e-05 | |
| PRK06841 | 255 | PRK06841, PRK06841, short chain dehydrogenase; Pro | 7e-05 | |
| PRK05565 | 247 | PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) | 8e-05 | |
| cd05343 | 250 | cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c | 1e-04 | |
| cd08931 | 227 | cd08931, SDR_c9, classical (c) SDR, subgroup 9 | 1e-04 | |
| PRK07060 | 245 | PRK07060, PRK07060, short chain dehydrogenase; Pro | 1e-04 | |
| PRK05693 | 274 | PRK05693, PRK05693, short chain dehydrogenase; Pro | 1e-04 | |
| TIGR01829 | 242 | TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta | 2e-04 | |
| cd08929 | 226 | cd08929, SDR_c4, classical (c) SDR, subgroup 4 | 2e-04 | |
| PRK05650 | 270 | PRK05650, PRK05650, short chain dehydrogenase; Pro | 2e-04 | |
| PRK09072 | 263 | PRK09072, PRK09072, short chain dehydrogenase; Pro | 2e-04 | |
| TIGR02415 | 254 | TIGR02415, 23BDH, acetoin reductases | 2e-04 | |
| PRK06550 | 235 | PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) | 2e-04 | |
| PRK08251 | 248 | PRK08251, PRK08251, short chain dehydrogenase; Pro | 2e-04 | |
| cd05361 | 242 | cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de | 3e-04 | |
| cd05329 | 251 | cd05329, TR_SDR_c, tropinone reductase-I and II (T | 3e-04 | |
| PRK12938 | 246 | PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro | 3e-04 | |
| cd05356 | 239 | cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst | 4e-04 | |
| PRK12828 | 239 | PRK12828, PRK12828, short chain dehydrogenase; Pro | 5e-04 | |
| PRK07231 | 251 | PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) | 6e-04 | |
| PRK07109 | 334 | PRK07109, PRK07109, short chain dehydrogenase; Pro | 7e-04 | |
| cd05347 | 248 | cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena | 7e-04 | |
| PRK12827 | 249 | PRK12827, PRK12827, short chain dehydrogenase; Pro | 0.001 | |
| cd05355 | 270 | cd05355, SDR_c1, classical (c) SDR, subgroup 1 | 0.001 | |
| cd09805 | 281 | cd09805, type2_17beta_HSD-like_SDR_c, human 17beta | 0.001 | |
| cd05326 | 249 | cd05326, secoisolariciresinol-DH_like_SDR_c, secoi | 0.002 | |
| PRK07326 | 237 | PRK07326, PRK07326, short chain dehydrogenase; Pro | 0.003 | |
| PRK07814 | 263 | PRK07814, PRK07814, short chain dehydrogenase; Pro | 0.004 | |
| PRK08226 | 263 | PRK08226, PRK08226, short chain dehydrogenase; Pro | 0.004 | |
| cd05344 | 253 | cd05344, BKR_like_SDR_like, putative beta-ketoacyl | 0.004 |
| >gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs | Back alignment and domain information |
|---|
Score = 85.0 bits (211), Expect = 2e-21
Identities = 38/118 (32%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
Query: 2 VIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAGL 61
+I+ G+ S LL+ +++++TFE++ L+HFW + FL ML GH VT++SVAGL
Sbjct: 80 LINNAGVVSGKKLLELPDEEIEKTFEVNTLAHFWTTKAFLPDMLERNHGHIVTIASVAGL 139
Query: 62 TGQPHHTSMAASQFAVQGLSEALAQQL--WKKPNVHVTLVHIYPFLLSADLKSNIRLR 117
AS+ A G E+L +L + KP + TLV P+ ++ + ++
Sbjct: 140 ISPAGLADYCASKAAAVGFHESLRLELKAYGKPGIKTTLVC--PYFINTGMFQGVKTP 195
|
17-beta-hydroxysteroid dehydrogenases (17betaHSD) are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. 17betaHSD type XI, a classical SDR, preferentially converts 3alpha-adiol to androsterone but not numerous other tested steroids. This subgroup of classical SDRs also includes members identified as retinol dehydrogenases, which convert retinol to retinal, a property that overlaps with 17betaHSD activity. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs. Length = 243 |
| >gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 | Back alignment and domain information |
|---|
| >gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 | Back alignment and domain information |
|---|
| >gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) | Back alignment and domain information |
|---|
| >gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235713 PRK06139, PRK06139, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 | Back alignment and domain information |
|---|
| >gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 | Back alignment and domain information |
|---|
| >gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 | Back alignment and domain information |
|---|
| >gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 | Back alignment and domain information |
|---|
| >gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 | Back alignment and domain information |
|---|
| >gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases | Back alignment and domain information |
|---|
| >gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 99.96 | |
| KOG1201|consensus | 300 | 99.96 | ||
| KOG1205|consensus | 282 | 99.96 | ||
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 99.95 | |
| KOG1200|consensus | 256 | 99.95 | ||
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 99.95 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 99.94 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.94 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.94 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 99.93 | |
| KOG1610|consensus | 322 | 99.93 | ||
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.93 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 99.93 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 99.93 | |
| PRK06300 | 299 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.93 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.93 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.93 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 99.93 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.93 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 99.93 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.93 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 99.92 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.92 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.92 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 99.92 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 99.92 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 99.92 | |
| KOG0725|consensus | 270 | 99.92 | ||
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 99.92 | |
| PF13561 | 241 | adh_short_C2: Enoyl-(Acyl carrier protein) reducta | 99.91 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.91 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 99.91 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 99.91 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.91 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 99.91 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.91 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 99.91 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 99.91 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 99.91 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 99.91 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.91 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 99.91 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 99.91 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 99.9 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 99.9 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 99.9 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 99.9 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 99.9 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 99.9 | |
| KOG1207|consensus | 245 | 99.9 | ||
| TIGR01500 | 256 | sepiapter_red sepiapterin reductase. This model de | 99.9 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 99.9 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 99.9 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 99.9 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 99.89 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 99.89 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 99.89 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 99.89 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 99.89 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 99.89 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 99.89 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 99.89 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 99.89 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 99.89 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 99.89 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 99.89 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 99.89 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 99.89 | |
| PRK08643 | 256 | acetoin reductase; Validated | 99.89 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 99.89 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 99.89 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 99.89 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 99.89 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 99.89 | |
| KOG1204|consensus | 253 | 99.89 | ||
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.88 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 99.88 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 99.88 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 99.88 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 99.88 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 99.88 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 99.88 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 99.88 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 99.87 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 99.87 | |
| TIGR01831 | 239 | fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas | 99.87 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 99.87 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.87 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 99.87 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.87 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 99.87 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 99.87 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 99.87 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 99.87 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 99.87 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.87 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 99.87 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 99.87 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 99.87 | |
| PRK09009 | 235 | C factor cell-cell signaling protein; Provisional | 99.87 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.87 | |
| PLN00015 | 308 | protochlorophyllide reductase | 99.87 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 99.87 | |
| COG1028 | 251 | FabG Dehydrogenases with different specificities ( | 99.87 | |
| KOG1611|consensus | 249 | 99.87 | ||
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 99.86 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 99.86 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 99.86 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 99.86 | |
| TIGR02685 | 267 | pter_reduc_Leis pteridine reductase. Pteridine red | 99.86 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 99.86 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 99.86 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 99.85 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK05717 | 255 | oxidoreductase; Validated | 99.85 | |
| KOG1209|consensus | 289 | 99.85 | ||
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK12428 | 241 | 3-alpha-hydroxysteroid dehydrogenase; Provisional | 99.85 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 99.85 | |
| KOG1210|consensus | 331 | 99.85 | ||
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 99.84 | |
| KOG4169|consensus | 261 | 99.84 | ||
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 99.84 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.84 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.83 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 99.83 | |
| KOG1014|consensus | 312 | 99.83 | ||
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 99.83 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 99.83 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 99.83 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 99.83 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 99.83 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 99.83 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.83 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 99.83 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 99.83 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 99.83 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 99.82 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 99.82 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 99.82 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 99.82 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 99.82 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 99.82 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 99.82 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 99.82 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 99.82 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.82 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 99.82 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 99.82 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 99.81 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.81 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 99.81 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 99.81 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 99.8 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.8 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 99.8 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 99.8 | |
| PRK07041 | 230 | short chain dehydrogenase; Provisional | 99.8 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 99.8 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.79 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 99.79 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.78 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.78 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 99.78 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 99.78 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 99.78 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 99.78 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 99.77 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 99.77 | |
| TIGR01830 | 239 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re | 99.76 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 99.76 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 99.76 | |
| KOG1208|consensus | 314 | 99.75 | ||
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 99.74 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.74 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 99.74 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 99.74 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 99.72 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 99.68 | |
| KOG1199|consensus | 260 | 99.66 | ||
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.64 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 99.63 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 99.61 | |
| COG0623 | 259 | FabI Enoyl-[acyl-carrier-protein] | 99.6 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 99.52 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 99.46 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 99.18 | |
| PF08643 | 299 | DUF1776: Fungal family of unknown function (DUF177 | 99.07 | |
| PF08659 | 181 | KR: KR domain; InterPro: IPR013968 This domain is | 98.96 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 98.93 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 98.86 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 98.83 | |
| KOG1478|consensus | 341 | 98.72 | ||
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 98.66 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 98.57 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 98.5 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 98.47 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 98.45 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 98.45 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 98.44 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 98.44 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 98.42 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 98.4 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 98.4 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 98.3 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 98.25 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 98.21 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 98.15 | |
| KOG4022|consensus | 236 | 98.14 | ||
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 98.13 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.11 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 98.1 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 98.09 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 98.08 | |
| COG1088 | 340 | RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope | 98.04 | |
| TIGR02197 | 314 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epime | 98.0 | |
| PLN02725 | 306 | GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas | 97.98 | |
| PF01073 | 280 | 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso | 97.98 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 97.95 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 97.91 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 97.87 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 97.77 | |
| PF07993 | 249 | NAD_binding_4: Male sterility protein; InterPro: I | 97.75 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 97.72 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 97.68 | |
| KOG1502|consensus | 327 | 97.66 | ||
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 97.65 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 97.59 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 97.58 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 97.56 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 97.54 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 97.53 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 97.52 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 97.3 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 97.07 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 97.04 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 97.04 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 97.03 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 96.97 | |
| PLN02996 | 491 | fatty acyl-CoA reductase | 96.86 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 96.52 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo | 96.39 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 96.31 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 96.28 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 96.24 | |
| COG3320 | 382 | Putative dehydrogenase domain of multifunctional n | 96.16 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 96.02 | |
| KOG0747|consensus | 331 | 95.97 | ||
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 95.85 | |
| KOG1430|consensus | 361 | 95.72 | ||
| PRK05865 | 854 | hypothetical protein; Provisional | 95.25 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 94.84 | |
| TIGR02114 | 227 | coaB_strep phosphopantothenate--cysteine ligase, s | 92.91 | |
| KOG1202|consensus | 2376 | 92.17 | ||
| PLN02503 | 605 | fatty acyl-CoA reductase 2 | 91.96 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 91.77 | |
| KOG1371|consensus | 343 | 88.4 | ||
| PRK06732 | 229 | phosphopantothenate--cysteine ligase; Validated | 86.32 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 85.58 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 84.79 | |
| KOG1221|consensus | 467 | 80.41 |
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.96 E-value=1.6e-28 Score=157.33 Aligned_cols=111 Identities=22% Similarity=0.265 Sum_probs=105.0
Q ss_pred CEEecccccCCCCCCCCCHHHHHHHHhhhhHHHHHHHHHHHHhhhcCCCCeEEEecCCccccCCCCCcchhhhHHHHHHH
Q psy9125 1 MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAGLTGQPHHTSMAASQFAVQGL 80 (117)
Q Consensus 1 ivv~~ag~~~~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~~~~~~g~iv~vss~~~~~~~~~~~~y~~sK~a~~~~ 80 (117)
++|||||.....++.+.+.++|++++++|+.|.++.+++++|.|.+++.|+||++||+.+..++++...|+++|+++..|
T Consensus 84 iLvNNAGl~~g~~~~~~~~~dw~~Mid~Ni~G~l~~~~avLP~m~~r~~G~IiN~~SiAG~~~y~~~~vY~ATK~aV~~f 163 (246)
T COG4221 84 ILVNNAGLALGDPLDEADLDDWDRMIDTNVKGLLNGTRAVLPGMVERKSGHIINLGSIAGRYPYPGGAVYGATKAAVRAF 163 (246)
T ss_pred EEEecCCCCcCChhhhCCHHHHHHHHHHHHHHHHHHHHHhhhHHHhcCCceEEEeccccccccCCCCccchhhHHHHHHH
Confidence 58999999988999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcCCCCCeEEEEEeCCcccCcccccc
Q psy9125 81 SEALAQQLWKKPNVHVTLVHIYPFLLSADLKSNI 114 (117)
Q Consensus 81 ~~~l~~e~~~~~~~~i~v~~v~pg~~~t~~~~~~ 114 (117)
++.++.|+... +|||..|.||.+.|..+...
T Consensus 164 s~~LR~e~~g~---~IRVt~I~PG~v~~~~~s~v 194 (246)
T COG4221 164 SLGLRQELAGT---GIRVTVISPGLVETTEFSTV 194 (246)
T ss_pred HHHHHHHhcCC---CeeEEEecCceecceecccc
Confidence 99999999866 99999999999977655433
|
|
| >KOG1201|consensus | Back alignment and domain information |
|---|
| >KOG1205|consensus | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1200|consensus | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1610|consensus | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06300 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0725|consensus | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1207|consensus | Back alignment and domain information |
|---|
| >TIGR01500 sepiapter_red sepiapterin reductase | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07578 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1204|consensus | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09009 C factor cell-cell signaling protein; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00015 protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG1611|consensus | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02685 pter_reduc_Leis pteridine reductase | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >KOG1209|consensus | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1210|consensus | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG4169|consensus | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1014|consensus | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07041 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >KOG1208|consensus | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1199|consensus | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0623 FabI Enoyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function | Back alignment and domain information |
|---|
| >PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >KOG1478|consensus | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >KOG4022|consensus | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase | Back alignment and domain information |
|---|
| >PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase | Back alignment and domain information |
|---|
| >PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >KOG1502|consensus | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02996 fatty acyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >KOG0747|consensus | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >KOG1430|consensus | Back alignment and domain information |
|---|
| >PRK05865 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal | Back alignment and domain information |
|---|
| >KOG1202|consensus | Back alignment and domain information |
|---|
| >PLN02503 fatty acyl-CoA reductase 2 | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >KOG1371|consensus | Back alignment and domain information |
|---|
| >PRK06732 phosphopantothenate--cysteine ligase; Validated | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >KOG1221|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 117 | ||||
| 1yb1_A | 272 | Crystal Structure Of Human 17-Beta-Hydroxysteroid D | 2e-08 | ||
| 1iol_A | 327 | Estrogenic 17-beta Hydroxysteroid Dehydrogenase Com | 6e-07 | ||
| 1fdu_A | 327 | Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M | 1e-06 | ||
| 1a27_A | 289 | Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C | 1e-06 | ||
| 1fdw_A | 327 | Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M | 1e-06 | ||
| 1equ_A | 327 | Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin | 1e-06 | ||
| 1fds_A | 327 | Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C | 1e-06 | ||
| 2c07_A | 285 | Oxoacyl-Acp Reductase Of Plasmodium Falciparum Leng | 2e-06 | ||
| 3enn_A | 249 | 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN | 5e-06 | ||
| 3emk_A | 246 | 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN | 5e-06 | ||
| 2hsd_A | 253 | The Refined Three-Dimensional Structure Of 3alpha,2 | 6e-06 | ||
| 1hdc_A | 254 | Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste | 6e-06 | ||
| 3ftp_A | 270 | Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote | 7e-06 | ||
| 3f9i_A | 249 | Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote | 1e-05 | ||
| 2nm0_A | 253 | Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl | 2e-05 | ||
| 3tsc_A | 277 | Crystal Structure Of Short Chain Dehydrogenase Map_ | 2e-05 | ||
| 3r3s_A | 294 | Structure Of The Ygha Oxidoreductase From Salmonell | 3e-05 | ||
| 1nff_A | 260 | Crystal Structure Of Rv2002 Gene Product From Mycob | 3e-05 | ||
| 2pd6_A | 264 | Structure Of Human Hydroxysteroid Dehydrogenase Typ | 7e-05 | ||
| 1y5m_A | 276 | The Crystal Structure Of Murine 11b-Hydroxysteroid | 1e-04 | ||
| 3ezl_A | 256 | Crystal Structure Of Acetyacetyl-Coa Reductase From | 1e-04 | ||
| 1nfr_A | 260 | Rv2002 Gene Product From Mycobacterium Tuberculosis | 2e-04 | ||
| 3p19_A | 266 | Improved Nadph-Dependent Blue Fluorescent Protein L | 2e-04 | ||
| 2wdz_A | 254 | Crystal Structure Of The Short Chain Dehydrogenase | 3e-04 | ||
| 3sj7_A | 252 | Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) F | 3e-04 | ||
| 3grp_A | 266 | 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- | 4e-04 | ||
| 1xu7_A | 286 | Crystal Structure Of The Interface Open Conformatio | 5e-04 | ||
| 3d5q_A | 272 | Crystal Structure Of 11b-Hsd1 In Complex With Triaz | 5e-04 | ||
| 2rbe_A | 275 | The Discovery Of 2-Anilinothiazolones As 11beta-Hsd | 5e-04 | ||
| 2irw_A | 264 | Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W | 5e-04 | ||
| 3gmd_A | 264 | Structure-Based Design Of 7-Azaindole-Pyrrolidines | 5e-04 | ||
| 2uvd_A | 246 | The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier | 5e-04 | ||
| 3pdj_A | 273 | Crystal Structure Of Human 11-Beta-Hydroxysteroid D | 6e-04 | ||
| 2ilt_A | 275 | Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W | 6e-04 | ||
| 3ch6_A | 286 | Crystal Structure Of 11beta-Hsd1 Double Mutant (L26 | 7e-04 | ||
| 4bb5_A | 292 | Free-Wilson And Structural Approaches To Co-Optimis | 7e-04 | ||
| 2bel_A | 283 | Structure Of Human 11-Beta-Hydroxysteroid Dehydroge | 7e-04 | ||
| 2ntn_A | 267 | Crystal Structure Of Maba-c60v/g139a/s144l Length = | 8e-04 | ||
| 1uzm_A | 247 | Maba From Mycobacterium Tuberculosis Length = 247 | 8e-04 | ||
| 4bb6_A | 292 | Free-Wilson And Structural Approaches To Co-Optimis | 9e-04 |
| >pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 | Back alignment and structure |
|
| >pdb|1IOL|A Chain A, Estrogenic 17-beta Hydroxysteroid Dehydrogenase Complexed 17-beta- Estradiol Length = 327 | Back alignment and structure |
| >pdb|1FDU|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221l Complexed With Estradiol And Nadp+ Length = 327 | Back alignment and structure |
| >pdb|1A27|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C-Terminal Deletion Mutant Complexed With Estradiol And Nadp+ Length = 289 | Back alignment and structure |
| >pdb|1FDW|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221q Complexed With Estradiol Length = 327 | Back alignment and structure |
| >pdb|1EQU|A Chain A, Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin Complexed With Nadp+ Length = 327 | Back alignment and structure |
| >pdb|1FDS|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Complexed With 17- Beta-Estradiol Length = 327 | Back alignment and structure |
| >pdb|2C07|A Chain A, Oxoacyl-Acp Reductase Of Plasmodium Falciparum Length = 285 | Back alignment and structure |
| >pdb|3ENN|A Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE FROM BRUCELLA Melitensis (P43212) Length = 249 | Back alignment and structure |
| >pdb|3EMK|A Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis Length = 246 | Back alignment and structure |
| >pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 | Back alignment and structure |
| >pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 | Back alignment and structure |
| >pdb|3FTP|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Burkholderia Pseudomallei At 2.05 A Resolution Length = 270 | Back alignment and structure |
| >pdb|3F9I|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase Rickettsia Prowazekii Length = 249 | Back alignment and structure |
| >pdb|2NM0|A Chain A, Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl Carrier Protein Reductase From Streptomyces Coelicolor A3(2) Length = 253 | Back alignment and structure |
| >pdb|3TSC|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Map_2410 From Mycobacterium Paratuberculosis Bound To Nad Length = 277 | Back alignment and structure |
| >pdb|3R3S|A Chain A, Structure Of The Ygha Oxidoreductase From Salmonella Enterica Length = 294 | Back alignment and structure |
| >pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 | Back alignment and structure |
| >pdb|2PD6|A Chain A, Structure Of Human Hydroxysteroid Dehydrogenase Type 8, Hsd17b8 Length = 264 | Back alignment and structure |
| >pdb|1Y5M|A Chain A, The Crystal Structure Of Murine 11b-Hydroxysteroid Dehydrogenase: An Important Therapeutic Target For Diabetes Length = 276 | Back alignment and structure |
| >pdb|3EZL|A Chain A, Crystal Structure Of Acetyacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 256 | Back alignment and structure |
| >pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 | Back alignment and structure |
| >pdb|3P19|A Chain A, Improved Nadph-Dependent Blue Fluorescent Protein Length = 266 | Back alignment and structure |
| >pdb|2WDZ|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase Galactitol-Dehydrogenase (Gatdh) Of Rhodobacter Sphaeroides In Complex With Nad+ And 1,2-Pentandiol Length = 254 | Back alignment and structure |
| >pdb|3SJ7|A Chain A, Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) From Staphylococcus Aureus Complex With Nadph Length = 252 | Back alignment and structure |
| >pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 | Back alignment and structure |
| >pdb|1XU7|A Chain A, Crystal Structure Of The Interface Open Conformation Of Tetrameric 11b-hsd1 Length = 286 | Back alignment and structure |
| >pdb|3D5Q|A Chain A, Crystal Structure Of 11b-Hsd1 In Complex With Triazole Inhibitor Length = 272 | Back alignment and structure |
| >pdb|2RBE|A Chain A, The Discovery Of 2-Anilinothiazolones As 11beta-Hsd1 Inhibitors Length = 275 | Back alignment and structure |
| >pdb|2IRW|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Ether Inhibitor Length = 264 | Back alignment and structure |
| >pdb|3GMD|A Chain A, Structure-Based Design Of 7-Azaindole-Pyrrolidines As Inhibitors Of 11beta-Hydroxysteroid-Dehydrogenase Type I Length = 264 | Back alignment and structure |
| >pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 | Back alignment and structure |
| >pdb|3PDJ|A Chain A, Crystal Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase 1 (11b-Hsd1) In Complex With 4,4-Disubstituted Cyclohexylbenzamide Inhibitor Length = 273 | Back alignment and structure |
| >pdb|2ILT|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Sulfone Inhibitor Length = 275 | Back alignment and structure |
| >pdb|3CH6|A Chain A, Crystal Structure Of 11beta-Hsd1 Double Mutant (L262r, F278e) Complexed With (3,3-Dimethylpiperidin-1-Yl)(6-(3- Fluoro-4-Methylphenyl)pyridin-2-Yl)methanone Length = 286 | Back alignment and structure |
| >pdb|4BB5|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 | Back alignment and structure |
| >pdb|2BEL|A Chain A, Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase In Complex With Nadp And Carbenoxolone Length = 283 | Back alignment and structure |
| >pdb|2NTN|A Chain A, Crystal Structure Of Maba-c60v/g139a/s144l Length = 267 | Back alignment and structure |
| >pdb|1UZM|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 | Back alignment and structure |
| >pdb|4BB6|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 117 | |||
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 2e-28 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 1e-19 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 5e-16 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 3e-15 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 9e-15 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 2e-14 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 2e-13 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 4e-13 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 2e-12 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 8e-12 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 1e-11 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 2e-11 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 7e-11 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 9e-11 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 5e-10 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 8e-10 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 2e-09 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 3e-09 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 4e-09 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 1e-08 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 2e-08 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 4e-08 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 5e-08 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 1e-07 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 1e-07 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 1e-07 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 1e-07 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 1e-07 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 2e-07 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 2e-07 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 3e-07 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 3e-07 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 4e-07 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 4e-07 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 4e-07 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 5e-07 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 5e-07 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 6e-07 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 6e-07 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 6e-07 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 6e-07 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 7e-07 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 7e-07 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 8e-07 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 8e-07 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 9e-07 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 9e-07 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 9e-07 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 1e-06 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 1e-06 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 1e-06 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 1e-06 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 1e-06 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 1e-06 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 1e-06 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 2e-06 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 2e-06 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 2e-06 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 2e-06 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 2e-06 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 2e-06 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 2e-06 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 2e-06 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 2e-06 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 2e-06 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 3e-06 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 3e-06 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 3e-06 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 3e-06 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 3e-06 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 4e-06 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 4e-06 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 4e-06 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 4e-06 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 5e-06 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 5e-06 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 7e-06 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 8e-06 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 1e-05 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 1e-05 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 1e-05 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 1e-05 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 1e-05 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 1e-05 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 2e-05 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 2e-05 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 2e-05 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 2e-05 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 2e-05 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 2e-05 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 2e-05 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 2e-05 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 3e-05 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 3e-05 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 3e-05 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 4e-05 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 4e-05 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 5e-05 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 5e-05 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 6e-05 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 6e-05 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 6e-05 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 6e-05 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 6e-05 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 7e-05 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 7e-05 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 7e-05 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 8e-05 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 9e-05 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 9e-05 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 1e-04 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 1e-04 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 1e-04 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 1e-04 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 1e-04 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 1e-04 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 1e-04 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 2e-04 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 2e-04 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 2e-04 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 2e-04 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 2e-04 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 2e-04 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 2e-04 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 2e-04 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 3e-04 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 3e-04 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 3e-04 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 3e-04 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 4e-04 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 4e-04 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 4e-04 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 4e-04 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 5e-04 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 5e-04 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 5e-04 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 8e-04 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 8e-04 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 8e-04 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 8e-04 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 9e-04 |
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 | Back alignment and structure |
|---|
Score = 103 bits (258), Expect = 2e-28
Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 4/119 (3%)
Query: 1 MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAG 60
++++ G+ L ++++TFE++VL+HFW + FL M + GH VT++S AG
Sbjct: 111 ILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAG 170
Query: 61 LTGQPHHTSMAASQFAVQGLSEALAQQLW--KKPNVHVTLVHIYPFLLSADLKSNIRLR 117
P + +S+FA G + L +L + V T + P ++ N
Sbjct: 171 HVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLC--PNFVNTGFIKNPSTS 227
|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 100.0 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 100.0 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 100.0 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 99.97 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 99.97 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 99.97 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 99.97 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 99.97 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 99.95 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 99.95 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 99.95 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 99.95 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 99.95 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 99.95 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 99.95 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 99.95 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 99.95 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 99.95 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 99.95 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 99.95 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.95 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 99.95 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 99.95 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 99.95 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 99.95 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 99.95 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 99.95 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 99.95 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.95 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 99.95 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 99.95 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 99.95 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 99.95 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 99.94 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 99.94 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 99.94 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 99.94 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 99.94 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 99.94 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 99.94 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 99.94 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 99.94 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 99.94 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 99.94 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 99.94 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 99.94 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.94 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 99.94 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 99.94 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.94 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.94 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 99.94 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 99.94 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 99.94 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 99.94 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 99.94 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 99.94 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 99.94 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 99.94 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 99.94 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 99.94 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 99.94 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 99.94 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 99.94 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 99.94 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 99.94 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 99.94 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 99.94 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 99.94 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 99.94 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 99.94 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 99.94 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 99.94 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 99.94 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 99.94 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 99.94 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.94 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 99.93 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 99.93 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 99.93 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 99.93 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 99.93 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 99.93 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 99.93 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 99.93 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 99.93 | |
| 3lt0_A | 329 | Enoyl-ACP reductase; triclosan, triclosan variant, | 99.93 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 99.93 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 99.93 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 99.93 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.93 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 99.93 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 99.93 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 99.93 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 99.93 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 99.93 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 99.93 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 99.93 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 99.93 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 99.93 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 99.93 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 99.93 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 99.93 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 99.93 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 99.93 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 99.93 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 99.93 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 99.93 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 99.93 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 99.93 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 99.93 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.93 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 99.93 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 99.93 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.93 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 99.93 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 99.93 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 99.93 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 99.93 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 99.93 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 99.93 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 99.93 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 99.93 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 99.93 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.93 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 99.93 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 99.92 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 99.92 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 99.92 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 99.92 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 99.92 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 99.92 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 99.92 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 99.92 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 99.92 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 99.92 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 99.92 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 99.92 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 99.92 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 99.92 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 99.92 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 99.92 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 99.92 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 99.92 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 99.92 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 99.92 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 99.92 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 99.92 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 99.92 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 99.92 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 99.92 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 99.92 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 99.92 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 99.92 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 99.92 | |
| 2ptg_A | 319 | Enoyl-acyl carrier reductase; apicomplexa, enoyl ( | 99.91 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 99.91 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 99.91 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 99.91 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 99.91 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.91 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 99.91 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 99.91 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 99.91 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 99.91 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 99.91 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 99.91 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 99.91 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 99.91 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 99.91 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 99.91 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 99.91 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 99.91 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 99.91 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 99.9 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 99.9 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 99.9 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 99.9 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 99.9 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 99.9 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 99.9 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 99.9 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 99.9 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 99.9 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 99.9 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 99.9 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 99.9 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 99.9 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 99.89 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 99.89 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 99.89 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 99.89 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 99.89 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 99.89 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 99.89 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 99.89 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 99.89 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 99.89 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 99.89 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 99.88 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 99.88 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 99.88 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 99.87 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 99.87 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 99.87 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 99.87 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 99.87 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 99.86 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 99.86 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 99.86 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 99.86 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 99.84 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 99.84 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 99.82 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 99.81 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 99.77 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 99.77 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 99.76 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 99.75 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 99.72 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 99.69 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 99.59 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 99.56 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 99.51 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 99.49 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 99.35 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 99.3 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 99.28 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 99.23 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 99.22 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 99.21 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 99.19 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 99.19 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 99.19 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 99.18 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 99.17 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 99.16 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 99.13 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 99.12 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 99.1 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 99.08 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 99.06 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 99.05 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 99.04 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 99.04 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 99.04 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 99.02 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 99.0 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 98.99 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 98.98 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 98.98 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 98.97 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 98.96 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 98.95 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 98.94 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 98.94 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 98.93 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 98.92 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 98.92 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 98.91 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 98.91 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 98.89 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 98.89 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 98.86 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 98.85 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 98.83 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 98.83 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 98.82 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 98.8 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 98.8 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 98.8 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 98.79 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 98.79 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 98.78 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 98.78 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 98.77 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 98.77 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 98.75 | |
| 4ggo_A | 401 | Trans-2-enoyl-COA reductase; rossmann fold, oxidor | 98.73 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 98.73 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 98.7 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 98.68 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 98.64 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 98.64 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 98.64 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 98.6 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 98.6 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 98.56 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 98.54 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 98.51 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 98.49 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 98.48 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 98.44 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 98.41 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 98.39 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 98.37 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.32 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 98.3 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 98.23 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 97.96 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 97.93 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 97.92 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 97.69 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 97.6 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 97.42 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 97.01 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 96.7 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 96.44 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 96.23 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 96.17 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 95.53 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 95.52 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 94.6 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 94.3 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 92.78 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 92.75 |
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-33 Score=182.00 Aligned_cols=110 Identities=18% Similarity=0.316 Sum_probs=104.8
Q ss_pred CEEecccccCCCCCCCCCHHHHHHHHhhhhHHHHHHHHHHHHhhhcCC-CCeEEEecCCccccCCCCCcchhhhHHHHHH
Q psy9125 1 MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSG-RGHWVTLSSVAGLTGQPHHTSMAASQFAVQG 79 (117)
Q Consensus 1 ivv~~ag~~~~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~~~~~-~g~iv~vss~~~~~~~~~~~~y~~sK~a~~~ 79 (117)
++|||||+....++.+.+.++|++.+++|+.++|.++|+++|.|++++ +|+||++||..+..+.++...|+++|+|+.+
T Consensus 82 iLVNNAGi~~~~~~~~~~~~~w~~~~~vNl~g~f~~~~~~~~~m~~~g~~G~IVnisS~~~~~g~~~~~~Y~asKaav~~ 161 (247)
T 4hp8_A 82 ILVNNAGIIRRADSVEFSELDWDEVMDVNLKALFFTTQAFAKELLAKGRSGKVVNIASLLSFQGGIRVPSYTAAKHGVAG 161 (247)
T ss_dssp EEEECCCCCCCCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCCEEEEEECCGGGTSCCSSCHHHHHHHHHHHH
T ss_pred EEEECCCCCCCCCcccccHHHHHHHHHHHhHHHHHHHHHHHHHHHHhCCCcEEEEEechhhCCCCCCChHHHHHHHHHHH
Confidence 589999999999999999999999999999999999999999998774 6999999999999999999999999999999
Q ss_pred HHHHHHHHHhcCCCCCeEEEEEeCCcccCccccc
Q psy9125 80 LSEALAQQLWKKPNVHVTLVHIYPFLLSADLKSN 113 (117)
Q Consensus 80 ~~~~l~~e~~~~~~~~i~v~~v~pg~~~t~~~~~ 113 (117)
|+|+++.||+++ |||||+|+||+++|++.+.
T Consensus 162 ltr~lA~Ela~~---gIrVNaV~PG~i~T~~~~~ 192 (247)
T 4hp8_A 162 LTKLLANEWAAK---GINVNAIAPGYIETNNTEA 192 (247)
T ss_dssp HHHHHHHHHGGG---TEEEEEEEECSBCSGGGHH
T ss_pred HHHHHHHHHhhc---CeEEEEEeeCCCCCcchhh
Confidence 999999999977 9999999999999999864
|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 117 | ||||
| d1yb1a_ | 244 | c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase | 2e-16 | |
| d1jtva_ | 285 | c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi | 8e-14 | |
| d2d1ya1 | 248 | c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T | 1e-13 | |
| d1xg5a_ | 257 | c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 | 2e-13 | |
| d2ew8a1 | 247 | c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas | 2e-13 | |
| d1xu9a_ | 269 | c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase | 3e-13 | |
| d2bd0a1 | 240 | c.2.1.2 (A:2-241) Bacterial sepiapterin reductase | 4e-13 | |
| d1gz6a_ | 302 | c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do | 3e-12 | |
| d1xkqa_ | 272 | c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh | 4e-12 | |
| d1zk4a1 | 251 | c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase | 1e-11 | |
| d1edoa_ | 244 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 3e-11 | |
| d1hdca_ | 254 | c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr | 9e-11 | |
| d1ydea1 | 250 | c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase | 1e-10 | |
| d2c07a1 | 251 | c.2.1.2 (A:54-304) beta-keto acyl carrier protein | 2e-10 | |
| d1ja9a_ | 259 | c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc | 3e-10 | |
| d1q7ba_ | 243 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 6e-10 | |
| d1bdba_ | 276 | c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy | 1e-09 | |
| d1sbya1 | 254 | c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase | 3e-09 | |
| d1uaya_ | 241 | c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena | 2e-08 | |
| d1iy8a_ | 258 | c.2.1.2 (A:) Levodione reductase {Corynebacterium | 7e-08 | |
| d1wmaa1 | 275 | c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox | 8e-08 | |
| d2bgka1 | 268 | c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de | 2e-07 | |
| d2o23a1 | 248 | c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr | 8e-07 | |
| d2gdza1 | 254 | c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog | 9e-07 | |
| d1zema1 | 260 | c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba | 1e-06 | |
| d1o5ia_ | 234 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 1e-06 | |
| d1x1ta1 | 260 | c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge | 0.004 |
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: 17-beta-hydroxysteroid dehydrogenase type XI species: Human (Homo sapiens) [TaxId: 9606]
Score = 70.0 bits (171), Expect = 2e-16
Identities = 29/102 (28%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
Query: 1 MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAG 60
++++ G+ L ++++TFE++VL+HFW + FL M + GH VT++S AG
Sbjct: 87 ILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAG 146
Query: 61 LTGQPHHTSMAASQFAVQGLSEALAQQL--WKKPNVHVTLVH 100
P + +S+FA G + L +L + V T +
Sbjct: 147 HVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLC 188
|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 100.0 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 99.98 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 99.98 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 99.98 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 99.97 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 99.97 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 99.97 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 99.97 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 99.97 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 99.97 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 99.97 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 99.97 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 99.97 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 99.97 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 99.97 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 99.97 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 99.97 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 99.97 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 99.97 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 99.97 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 99.97 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 99.97 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 99.97 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 99.97 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 99.96 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 99.96 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 99.96 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 99.96 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 99.96 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 99.96 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 99.96 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 99.96 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 99.96 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 99.96 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 99.95 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 99.95 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 99.95 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 99.95 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 99.95 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 99.95 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 99.95 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 99.94 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 99.94 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 99.94 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 99.94 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 99.93 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 99.93 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 99.93 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 99.93 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 99.93 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 99.93 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 99.92 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 99.92 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 99.92 | |
| d1uh5a_ | 329 | Enoyl-ACP reductase {Malaria parasite (Plasmodium | 99.92 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 99.92 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 99.9 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 99.88 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 99.87 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 99.86 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 99.84 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 99.79 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 99.77 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 99.73 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 99.71 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 99.67 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 98.23 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 98.14 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 98.05 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 97.96 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 97.96 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 97.94 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 97.84 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 97.8 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 97.69 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 97.65 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 97.64 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 97.52 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 97.22 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 97.13 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 97.01 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 96.85 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 96.85 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 96.74 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 96.62 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 96.43 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 95.8 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 92.48 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 91.68 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 90.15 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 89.19 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 89.13 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 86.45 |
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Bacterial sepiapterin reductase species: Chlorobium tepidum [TaxId: 1097]
Probab=100.00 E-value=1.4e-32 Score=176.97 Aligned_cols=111 Identities=20% Similarity=0.283 Sum_probs=106.5
Q ss_pred CEEecccccCCCCCCCCCHHHHHHHHhhhhHHHHHHHHHHHHhhhcCCCCeEEEecCCccccCCCCCcchhhhHHHHHHH
Q psy9125 1 MVIHCCGLSSPHALLDRSMQKVKQTFELSVLSHFWLLEEFLTPMLSSGRGHWVTLSSVAGLTGQPHHTSMAASQFAVQGL 80 (117)
Q Consensus 1 ivv~~ag~~~~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~~~~~~g~iv~vss~~~~~~~~~~~~y~~sK~a~~~~ 80 (117)
++|||||.....++.+.+.++|++++++|+.+++.++|+++|+|+++++|+||++||..+..+.++...|+++|+|+.+|
T Consensus 88 ilvnnAg~~~~~~~~~~~~~~~~~~~~vNl~g~~~~~~~~~~~m~~~~~G~Ii~isS~~~~~~~~~~~~Y~asK~al~~l 167 (240)
T d2bd0a1 88 CLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFITSVAATKAFRHSSIYCMSKFGQRGL 167 (240)
T ss_dssp EEEECCCCCCCCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGTSCCTTCHHHHHHHHHHHHH
T ss_pred eeecccccccCCccccCCHHHHhhcCCEeehHHHHHHHHHhHHHHhcCCCceEEEechhhcCCCCCChHHHHHHHHHHHH
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcCCCCCeEEEEEeCCcccCcccccc
Q psy9125 81 SEALAQQLWKKPNVHVTLVHIYPFLLSADLKSNI 114 (117)
Q Consensus 81 ~~~l~~e~~~~~~~~i~v~~v~pg~~~t~~~~~~ 114 (117)
+|+++.|++++ |||||+|+||+++|+|.++.
T Consensus 168 t~~la~el~~~---gIrvn~i~PG~v~T~~~~~~ 198 (240)
T d2bd0a1 168 VETMRLYARKC---NVRITDVQPGAVYTPMWGKV 198 (240)
T ss_dssp HHHHHHHHTTT---TEEEEEEEECCBCSTTTCCC
T ss_pred HHHHHHHhCcC---CeEEEEeeeCcccCchhhhc
Confidence 99999999966 99999999999999998754
|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|