Diaphorina citri psyllid: psy9131


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MDTERMHRSTVGRECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGK
ccHHHHcccccEEECccEEEECcccCCccccccccccccccEEEEccccccccccEEEECcccEEEEEEccccHHccc
***********GRECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTERMHRSTVGRECCGKVFVDSAPEFQPPLSQLVDFSEVNMILISNYLSMLALPFITEGTGFEGVVYATEPTLQIGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Integrator complex subunit 9 Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.confidentQ9NV88
Integrator complex subunit 9 Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.confidentQ5ZKK2
Integrator complex subunit 9 Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.confidentQ2KJA6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034472 [BP]snRNA 3'-end processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0016180, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0034470, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0043628, GO:0046483, GO:0016070, GO:0044238, GO:0016073, GO:0044237, GO:0043170, GO:0006396
GO:0032039 [CC]integrator complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I7T, chain A
Confidence level:very confident
Coverage over the Query: 3-76
View the alignment between query and template
View the model in PyMOL