Diaphorina citri psyllid: psy9135


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------111
MSEARKSLKLPVYEGLLAEKTGVVLDIGSKYTKYGIFGSFQPKGVVLDIGSKYTKYGIFGSFQPKGFIKSQVKDPHTNKLRNLYEYKDADDLYGLLIEFIRKIFFKYFVTSPKDKRIVVVESVLTPTVWRNTLAKVLFKHYEVLSLLYVPSHLVSLCTLGVNTGLVLDIGYSEATLLPVYEGVPVLCAWKDLSLGGQSVEAHIRRGQSVESHIRSLLIDEIKALENPDPYIVTVEDVENLSDSIIEDIKVCSCFVTTMERSAEIAAKNPDHKYPSGFMYPLKNGKKIPVSGHIRETAFEVLFELDLDMLNIATIILDSLLSVASSDGREETQYFPFRCWVNTRTPEKLCCLVGWSNICCYKLFIKNFKFHEFPAKENYVAWLGGAIFAATESYNKRAIQKDVYLNNNVIPDWCNLSVLGTDLKKSVNPYLHFPVSGHIRETAFEVLFELDLDMLNIATIILDSLLKTGRDMKKPLAENILLTGGTAMTPGLKYRLLQELRTLIESPPYKDKLFIKNFKFHEFPAKENYVAWLGGAIFAATESYNKRAIQKDAYLNNNMTYMEFLGCTMTAFGPVIAMFLTTIMQDPVKVIILVASAFAWLLSLLLSSIVWFVIRYQCNIIFGVVISVLCQEAFRYILYLILQKSRGGLQYVSDRNTMDNTYAMAYVSGLGYGTISAAFSLLNVLDQVSGPGTMGLKGESQYFGFTTSIFTCCFSLLHVFWSIVFFRGVEIKNRTLKTGVVLDIGSKYTKYGIFGSFQPKGFIKSQVKDPHTNKLRNLYEYKDADDLYGLLIEFIRKIFFKYFVTSPKDKRIVVVESVLTPTVWRNTLAKVLFKHYEVLSLLYVPSHLVSLCTLGVNTGLVLDIGYSEATLLPVYEGVPVLCAWKDLSLGGGQSVESHIRSLLIDEIKALENPDPYIVTVEDVENLSDSIIEDIKVCSCFVTTMERSAEIAAKNPDHKYPSGFMYPLKNGKKIPVSGHIRETAFEVLFELDLDMLNIATIILDSLLSVASSDGREETQYFPFRCWVNTRTPEKLCCLVGWSNICCYKLFIKNFKFHEFPAKENYVAWLGGAIFAATESYNKRAIQKDVYLNNNVIPDWCNLSVNLPSG
cccccccccccccccccccccEEEEEcccccEECcccccccccCEECcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHHHcccccccEEEHHHHHHHHHccccccEEEEEcccccCEEEEEEcccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHccEEcccccccHHHHHHccccccccccccCECcccccCEECcccccccccccccccccccccHHHHHHHHHHcccccccHHccccccCCccccccccHHHHHHcccccccccccccccCEEEcccccccEEEEcHHHHHHcccccccEEECHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHcccEECccccccccHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccEEcccccccccccEEHHHHHHcccccEEEcccccccccccEEEEEEEEccccEEEEEEEHHHHHHHHHHHHHcEEEEEEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHccccCEEEEcccccccccEEEccccccccHHHHHHHHccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccccccccEEEEEcccccEEccccccccccCEECccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHHHHHHHcccccccEEEEHHHHHHHHccccccEEEEEcccccCEEEEEEccccccccEEccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccEEEEcccHHHHHHHHcccccccccccCECcccccCEECcccccccccccccccccccccHHHHHHHHHHcccccHHHHHcccccccccccccccHHHHHHcccccccccccccccEEEEccccccccccccccEEcccccccccccccHHHHHcccccccCECcccccccc
*********LPVYEGLLAEKTGVVLDIGSKYTKYGIFGSFQPKGVVLDIGSKYTKYGIFGSFQPKGFIKSQVKDPHTNKLRNLYEYKDADDLYGLLIEFIRKIFFKYFVTSPKDKRIVVVESVLTPTVWRNTLAKVLFKHYEVLSLLYVPSHLVSLCTLGVNTGLVLDIGYSEATLLPVYEGVPVLCAWKDLSLGGQSVEAHIRRGQSVESHIRSLLIDEIKALENPDPYIVTVEDVENLSDSIIEDIKVCSCFVTTMERSAEIAA****HKYPSGFMYPLKNGKKIPVSGHIRETAFEVLFELDLDMLNIATIILDSLLSVASSDGREETQYFPFRCWVNTRTPEKLCCLVGWSNICCYKLFIKNFKFHEFPAKENYVAWLGGAIFAATESYNKRAIQKDVYLNNNVIPDWCNLSVLGTDLKKSVNPYLHFPVSGHIRETAFEVLFELDLDMLNIATIILDSLLKTGRDMKKPLAENILLTGGTAMTPGLKYRLLQELRTLIESPPYKDKLFIKNFKFHEFPAKENYVAWLGGAIFAATESYNKRAIQKDAYLNNNMTYMEFLGCTMTAFGPVIAMFLTTIMQDPVKVIILVASAFAWLLSLLLSSIVWFVIRYQCNIIFGVVISVLCQEAFRYILYLILQKSRGGLQYVSDRNTMDNTYAMAYVSGLGYGTISAAFSLLNVLDQVSGPGTMGLKGESQYFGFTTSIFTCCFSLLHVFWSIVFFRGVEIKNRTLKTGVVLDIGSKYTKYGIFGSFQPKGFIKSQVKDPHTNKLRNLYEYKDADDLYGLLIEFIRKIFFKYFVTSPKDKRIVVVESVLTPTVWRNTLAKVLFKHYEVLSLLYVPSHLVSLCTLGVNTGLVLDIGYSEATLLPVYEGVPVLCAWKDLSLGGGQSVESHIRSLLIDEIKALENPDPYIVTVEDVENLSDSIIEDIKVCSCFVTTMERSAEIAA****HKYPSGFMYPLKNGKKIPVSGHIRETAFEVLFELDLDMLNIATIILDSLLSVASSDGREETQYFPFRCWVNTRTPEKLCCLVGWSNICCYKLFIKNFKFHEFPAKENYVAWLGGAIFAATESYNKRAIQKDVYLNNNVIPDWCNLS******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEARKSLKLPVYEGLLAEKTGVVLDIGSKYTKYGIFGSFQPKGVVLDIGSKYTKYGIFGSFQPKGFIKSQVKDPHTNKLRNLYEYKDADDLYGLLIEFIRKIFFKYFVTSPKDKRIVVVESVLTPTVWRNTLAKVLFKHYEVLSLLYVPSHLVSLCTLGVNTGLVLDIGYSEATLLPVYEGVPVLCAWKDLSLGGQSVEAHIRRGQSVESHIRSLLIDEIKALENPDPYIVTVEDVENLSDSIIEDIKVCSCFVTTMERSAEIAAKNPDHKYPSGFMYPLKNGKKIPVSGHIRETAFEVLFELDLDMLNIATIILDSLLSVASSDGREETQYFPFRCWVNTRTPEKLCCLVGWSNICCYKLFIKNFKFHEFPAKENYVAWLGGAIFAATESYNKRAIQKDVYLNNNVIPDWCNLSVLGTDLKKSVNPYLHFPVSGHIRETAFEVLFELDLDMLNIATIILDSLLKTGRDMKKPLAENILLTGGTAMTPGLKYRLLQELRTLIESPPYKDKLFIKNFKFHEFPAKENYVAWLGGAIFAATESYNKRAIQKDAYLNNNMTYMEFLGCTMTAFGPVIAMFLTTIMQDPVKVIILVASAFAWLLSLLLSSIVWFVIRYQCNIIFGVVISVLCQEAFRYILYLILQKSRGGLQYVSDRNTMDNTYAMAYVSGLGYGTISAAFSLLNVLDQVSGPGTMGLKGESQYFGFTTSIFTCCFSLLHVFWSIVFFRGVEIKNRTLKTGVVLDIGSKYTKYGIFGSFQPKGFIKSQVKDPHTNKLRNLYEYKDADDLYGLLIEFIRKIFFKYFVTSPKDKRIVVVESVLTPTVWRNTLAKVLFKHYEVLSLLYVPSHLVSLCTLGVNTGLVLDIGYSEATLLPVYEGVPVLCAWKDLSLGGGQSVESHIRSLLIDEIKALENPDPYIVTVEDVENLSDSIIEDIKVCSCFVTTMERSAEIAAKNPDHKYPSGFMYPLKNGKKIPVSGHIRETAFEVLFELDLDMLNIATIILDSLLSVASSDGREETQYFPFRCWVNTRTPEKLCCLVGWSNICCYKLFIKNFKFHEFPAKENYVAWLGGAIFAATESYNKRAIQKDVYLNNNVIPDWCNLSVNLPSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8K, chain A
Confidence level:very confident
Coverage over the Query: 41-206,221-291,429-558
View the alignment between query and template
View the model in PyMOL
Template: 1K8K, chain A
Confidence level:very confident
Coverage over the Query: 735-1099
View the alignment between query and template
View the model in PyMOL
Template: 3QB0, chain A
Confidence level:very confident
Coverage over the Query: 38-206,221-326,407-429,459-558
View the alignment between query and template
View the model in PyMOL
Template: 4AM6, chain A
Confidence level:confident
Coverage over the Query: 93-206,221-312,325-328,356-406,418-422,443-558
View the alignment between query and template
View the model in PyMOL
Template: 1YAG, chain A
Confidence level:probable
Coverage over the Query: 19-203,221-403
View the alignment between query and template
View the model in PyMOL
Template: 3B63, chain A
Confidence level:probable
Coverage over the Query: 737-1088
View the alignment between query and template
View the model in PyMOL