Diaphorina citri psyllid: psy9156

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------

VYSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGKNSLRSYVEASVSSGNMLKIAFTEI

cHHHHHHHcccccEEEEECccccccccccccccccccccHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHccccEEEEEEHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccEECcccHHHHHHHHHHHHHHHHccc

VYSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGKNSLRSYVEASVSSGNMLKIAFTEI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

VYSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGKNSLRSYVEASVSSGNMLKIAFTEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Guanylate kinase	Essential for recycling GMP and indirectly, cGMP.	confident	Q5N570
Guanylate kinase	Essential for recycling GMP and indirectly, cGMP.	confident	Q64520
Guanylate kinase	Essential for recycling GMP and indirectly, cGMP.	confident	P46195

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0046060 [BP]	dATP metabolic process	probable	GO:0009215, GO:0009141, GO:0009144, GO:0006139, GO:0034641, GO:0006807, GO:0044281, GO:0072521, GO:1901360, GO:0009394, GO:0044710, GO:0071704, GO:0009200, GO:0009987, GO:0006725, GO:0009151, GO:0009262, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:0019692, GO:0006163, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753
GO:0019673 [BP]	GDP-mannose metabolic process	probable	GO:0034641, GO:0006807, GO:0044281, GO:1901360, GO:0006139, GO:0044710, GO:0071704, GO:0009225, GO:0009987, GO:0006725, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901135, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753
GO:0046037 [BP]	GMP metabolic process	probable	GO:0009167, GO:0034641, GO:0006807, GO:0044237, GO:0009161, GO:0009123, GO:0009126, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0071704, GO:0042278, GO:1901068, GO:0009987, GO:0006725, GO:0009150, GO:0072521, GO:0009117, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034436 [BP]	glycoprotein transport	probable	GO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0044765, GO:0008150, GO:0071702, GO:0015031, GO:0051234, GO:0051179, GO:0044699, GO:1901264
GO:0046711 [BP]	GDP biosynthetic process	probable	GO:0009185, GO:0009180, GO:0046710, GO:0044237, GO:0009188, GO:0044249, GO:0034641, GO:0009165, GO:0009163, GO:0072521, GO:0072522, GO:0009133, GO:0009259, GO:1901360, GO:1901362, GO:1901576, GO:0044710, GO:0009132, GO:0090407, GO:0071704, GO:0009179, GO:0042278, GO:0008150, GO:1901068, GO:0055086, GO:0046483, GO:0044281, GO:0018130, GO:0009119, GO:0009987, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0009116, GO:0008152, GO:0034654, GO:1901564, GO:0042451, GO:0046128, GO:0009135, GO:0042455, GO:0009136, GO:0046129, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:1901070, GO:0006753, GO:1901659
GO:0006185 [BP]	dGDP biosynthetic process	probable	GO:0009186, GO:0009182, GO:0009183, GO:0009189, GO:0006807, GO:0044249, GO:0034641, GO:0009165, GO:0046066, GO:0044281, GO:0072521, GO:0072522, GO:1901362, GO:1901360, GO:0009394, GO:0044710, GO:0046385, GO:0090407, GO:0008150, GO:0071704, GO:0046483, GO:0018130, GO:0009987, GO:1901576, GO:0006725, GO:0006793, GO:0009153, GO:0009151, GO:0009263, GO:0009262, GO:0009117, GO:0008152, GO:0019438, GO:0034654, GO:1901564, GO:0009133, GO:0009132, GO:0009135, GO:0055086, GO:0009136, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0009058, GO:0044237, GO:0019692, GO:0006163, GO:0006796, GO:0006139, GO:1901293, GO:0006164, GO:0019637, GO:0009265, GO:0006753
GO:0046034 [BP]	ATP metabolic process	probable	GO:0009141, GO:0009144, GO:0034641, GO:0006807, GO:0044237, GO:0072521, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0071704, GO:0009199, GO:0009205, GO:0009987, GO:0006725, GO:0009150, GO:0009117, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0046054 [BP]	dGMP metabolic process	probable	GO:0034641, GO:0006807, GO:0009162, GO:0044281, GO:0072521, GO:0009123, GO:0009126, GO:1901360, GO:0009394, GO:0044710, GO:0071704, GO:0006139, GO:0009987, GO:0006725, GO:0009151, GO:0009262, GO:0009117, GO:0009170, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:0019692, GO:0006163, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753
GO:0065009 [BP]	regulation of molecular function	probable	GO:0008150, GO:0065007
GO:0031226 [CC]	intrinsic to plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0045211 [CC]	postsynaptic membrane	probable	GO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0005912 [CC]	adherens junction	probable	GO:0005575, GO:0070161, GO:0030054
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0048522 [BP]	positive regulation of cellular process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0004385 [MF]	guanylate kinase activity	probable	GO:0019201, GO:0019205, GO:0016772, GO:0016301, GO:0016776, GO:0003824, GO:0016740, GO:0003674
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0005923 [CC]	tight junction	probable	GO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0044306 [CC]	neuron projection terminus	probable	GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0022607 [BP]	cellular component assembly	probable	GO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0005856 [CC]	cytoskeleton	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044448 [CC]	cell cortex part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0031323 [BP]	regulation of cellular metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0043269 [BP]	regulation of ion transport	probable	GO:0008150, GO:0051049, GO:0032879, GO:0065007, GO:0050789
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0042734 [CC]	presynaptic membrane	probable	GO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0033267 [CC]	axon part	probable	GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0016328 [CC]	lateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.4.-	2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.	probable
2.7.4.8	Guanylate kinase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LVG, chain A
Confidence level:very confident
Coverage over the Query: 2-158
View the alignment between query and template
View the model in PyMOL