Psyllid ID: psy9156

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
VYSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGKNSLRSYVEASVSSGNMLKIAFTEI
cHHHHHHHcccccEEEEEEccccccccccccccccccccHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHccccEEEEEEHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccEEEcccHHHHHHHHHHHHHHHHccc
cHHHHHHHHHcccEEEcccEEcccccccccEcccEEEccHHHHHHHHHHccEEEEEEEccEEEEEEHHHHHHHHHcccEEEEEccHHHHHHHccHHccccccEEEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHcccEEEEEccHHHHHHHHHHHHHHHHHHHHcc
vysilffqdypdrfgfsvshttrgprpgevdgkayHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYvfvkppsieeLETRlrgrgteteDSLRRRLDLARRdmsygkdslrsygknsLRSYVEASVSSGNMLKIAFTEI
vysilffqdypdrfgfsvshttrgprpgevdgKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVyvfvkppsieeletrlrgrgtetedslrrrldlarrdmsygkdslrsygknslRSYVeasvssgnmlkiaftei
VYSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEdslrrrldlarrdMSYGKDSLRSYGKNSLRSYVEASVSSGNMLKIAFTEI
**SILFFQDYPDRFGFSVSH*********VDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKP********************************************************************
VYSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGKNSLRSYVEASVSSGNMLKIAFTEI
VYSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRL***********RRRLDLARRDMSYGKDSLRSYGKNSLRSYVEASVSSGNMLKIAFTEI
VYSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGKNSLRSYVEASVSSGNMLKIAFTEI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VYSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGKNSLRSYVEASVSSGNMLKIAFTEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
Q64520198 Guanylate kinase OS=Mus m yes N/A 0.779 0.696 0.560 4e-40
Q16774197 Guanylate kinase OS=Homo yes N/A 0.779 0.700 0.531 4e-37
P31006198 Guanylate kinase OS=Sus s yes N/A 0.779 0.696 0.546 2e-36
P46195198 Guanylate kinase OS=Bos t yes N/A 0.779 0.696 0.553 8e-36
P15454187 Guanylate kinase OS=Sacch yes N/A 0.779 0.737 0.492 2e-35
Q9P6I5202 Guanylate kinase OS=Schiz yes N/A 0.774 0.678 0.485 5e-33
Q54XF2202 Guanylate kinase OS=Dicty yes N/A 0.751 0.658 0.455 8e-32
Q8Z0I7199 Guanylate kinase OS=Nosto yes N/A 0.745 0.663 0.492 1e-31
Q3MD38199 Guanylate kinase OS=Anaba yes N/A 0.745 0.663 0.485 4e-31
Q5N570183 Guanylate kinase OS=Synec yes N/A 0.864 0.836 0.426 7e-30
>sp|Q64520|KGUA_MOUSE Guanylate kinase OS=Mus musculus GN=Guk1 PE=1 SV=2 Back     alignment and function desciption
 Score =  164 bits (414), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 3/141 (2%)

Query: 6   FFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGT 65
            FQ++   FGFSVSHTTR PRPGE DGK Y+FVTR  M+  IAAG+F+EHAEF+ NLYGT
Sbjct: 24  LFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGT 83

Query: 66  SRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTE 125
           S+ AV AV    + CVLD+++QGV+ +K+        +Y+FV+PPS++ LE RLR R TE
Sbjct: 84  SKEAVRAVQAMNRICVLDVDLQGVRSIKKTD---LCPIYIFVQPPSLDVLEQRLRLRNTE 140

Query: 126 TEDSLRRRLDLARRDMSYGKD 146
           TE+SL +RL  AR DM   K+
Sbjct: 141 TEESLAKRLAAARTDMESSKE 161
Essential for recycling GMP and indirectly, cGMP.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 8
>sp|Q16774|KGUA_HUMAN Guanylate kinase OS=Homo sapiens GN=GUK1 PE=1 SV=2 Back     alignment and function description
>sp|P31006|KGUA_PIG Guanylate kinase OS=Sus scrofa GN=GUK1 PE=1 SV=2 Back     alignment and function description
>sp|P46195|KGUA_BOVIN Guanylate kinase OS=Bos taurus GN=GUK1 PE=1 SV=2 Back     alignment and function description
>sp|P15454|KGUA_YEAST Guanylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9P6I5|KGUA_SCHPO Guanylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.05 PE=3 SV=1 Back     alignment and function description
>sp|Q54XF2|KGUA_DICDI Guanylate kinase OS=Dictyostelium discoideum GN=guk1 PE=3 SV=1 Back     alignment and function description
>sp|Q8Z0I7|KGUA_NOSS1 Guanylate kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gmk PE=3 SV=1 Back     alignment and function description
>sp|Q3MD38|KGUA_ANAVT Guanylate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gmk PE=3 SV=1 Back     alignment and function description
>sp|Q5N570|KGUA_SYNP6 Guanylate kinase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gmk PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
383863925216 PREDICTED: LOW QUALITY PROTEIN: guanylat 0.774 0.634 0.614 2e-45
156387610191 predicted protein [Nematostella vectensi 0.779 0.722 0.588 2e-44
328781717208 PREDICTED: guanylate kinase-like [Apis m 0.898 0.764 0.511 4e-44
189014430199 gualynate kinase-1 [Gryllus firmus] 0.768 0.683 0.611 2e-43
189014390199 gualynate kinase-1 [Gryllus pennsylvanic 0.768 0.683 0.611 3e-43
380025472194 PREDICTED: guanylate kinase-like [Apis f 0.774 0.706 0.571 3e-43
189014404199 gualynate kinase-1 [Gryllus pennsylvanic 0.768 0.683 0.604 5e-43
189014388199 gualynate kinase-1 [Gryllus pennsylvanic 0.768 0.683 0.604 5e-43
91082673196 PREDICTED: similar to guanylate kinase [ 0.751 0.678 0.588 2e-42
350417477214 PREDICTED: guanylate kinase-like [Bombus 0.774 0.640 0.571 5e-42
>gi|383863925|ref|XP_003707430.1| PREDICTED: LOW QUALITY PROTEIN: guanylate kinase-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 108/140 (77%), Gaps = 3/140 (2%)

Query: 6   FFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGT 65
            F+D+P+ FGFSVSHTTR PRPGE DGK YHF T+  M+++I  GEFLE A ++ NLYGT
Sbjct: 26  LFEDFPETFGFSVSHTTRAPRPGEEDGKHYHFTTKEKMQKQIEQGEFLETATYSGNLYGT 85

Query: 66  SRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTE 125
           S+ AVE V   GK C+LDIE+QGV+QVK++       +YVF+KPPSIE LE RL+GR TE
Sbjct: 86  SKRAVEQVQKDGKVCILDIEMQGVKQVKQSS---LDPLYVFIKPPSIEVLEERLKGRNTE 142

Query: 126 TEDSLRRRLDLARRDMSYGK 145
           T+DSLRRRL +AR +M YG+
Sbjct: 143 TDDSLRRRLSIARTEMEYGE 162

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156387610|ref|XP_001634296.1| predicted protein [Nematostella vectensis] gi|156221377|gb|EDO42233.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|328781717|ref|XP_624407.2| PREDICTED: guanylate kinase-like [Apis mellifera] Back     alignment and taxonomy information
>gi|189014430|gb|ACD69451.1| gualynate kinase-1 [Gryllus firmus] Back     alignment and taxonomy information
>gi|189014390|gb|ACD69431.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014392|gb|ACD69432.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014394|gb|ACD69433.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014402|gb|ACD69437.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014408|gb|ACD69440.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014410|gb|ACD69441.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014414|gb|ACD69443.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014420|gb|ACD69446.1| gualynate kinase-1 [Gryllus firmus] gi|189014422|gb|ACD69447.1| gualynate kinase-1 [Gryllus firmus] gi|189014426|gb|ACD69449.1| gualynate kinase-1 [Gryllus firmus] gi|189014428|gb|ACD69450.1| gualynate kinase-1 [Gryllus firmus] gi|189014434|gb|ACD69453.1| gualynate kinase-1 [Gryllus firmus] gi|189014438|gb|ACD69455.1| gualynate kinase-1 [Gryllus firmus] gi|189014442|gb|ACD69457.1| gualynate kinase-1 [Gryllus firmus] gi|189014444|gb|ACD69458.1| gualynate kinase-1 [Gryllus firmus] gi|189014446|gb|ACD69459.1| gualynate kinase-1 [Gryllus firmus] gi|189014448|gb|ACD69460.1| gualynate kinase-1 [Gryllus firmus] gi|189014450|gb|ACD69461.1| gualynate kinase-1 [Gryllus firmus] Back     alignment and taxonomy information
>gi|380025472|ref|XP_003696498.1| PREDICTED: guanylate kinase-like [Apis florea] Back     alignment and taxonomy information
>gi|189014404|gb|ACD69438.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014406|gb|ACD69439.1| gualynate kinase-1 [Gryllus pennsylvanicus] Back     alignment and taxonomy information
>gi|189014388|gb|ACD69430.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014396|gb|ACD69434.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014398|gb|ACD69435.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014400|gb|ACD69436.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014412|gb|ACD69442.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014416|gb|ACD69444.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014418|gb|ACD69445.1| gualynate kinase-1 [Gryllus pennsylvanicus] gi|189014424|gb|ACD69448.1| gualynate kinase-1 [Gryllus firmus] gi|189014432|gb|ACD69452.1| gualynate kinase-1 [Gryllus firmus] gi|189014436|gb|ACD69454.1| gualynate kinase-1 [Gryllus firmus] gi|189014440|gb|ACD69456.1| gualynate kinase-1 [Gryllus firmus] Back     alignment and taxonomy information
>gi|91082673|ref|XP_971278.1| PREDICTED: similar to guanylate kinase [Tribolium castaneum] gi|270015049|gb|EFA11497.1| hypothetical protein TcasGA2_TC014210 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350417477|ref|XP_003491441.1| PREDICTED: guanylate kinase-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
UNIPROTKB|E1C038198 GUK1 "Uncharacterized protein" 0.666 0.595 0.586 8.3e-35
MGI|MGI:95871198 Guk1 "guanylate kinase 1" [Mus 0.774 0.691 0.514 2e-33
UNIPROTKB|F1S5R9198 LOC100513720 "Uncharacterized 0.768 0.686 0.510 5.2e-33
UNIPROTKB|P31006198 GUK1 "Guanylate kinase" [Sus s 0.768 0.686 0.510 5.2e-33
UNIPROTKB|G8JKX7219 GUK1 "Guanylate kinase" [Bos t 0.768 0.621 0.510 6.7e-33
UNIPROTKB|P46195198 GUK1 "Guanylate kinase" [Bos t 0.768 0.686 0.510 6.7e-33
RGD|1309638198 Guk1 "guanylate kinase 1" [Rat 0.774 0.691 0.507 1.1e-32
UNIPROTKB|E9PTV0219 Guk1 "Protein Guk1" [Rattus no 0.774 0.625 0.507 1.1e-32
UNIPROTKB|F1PTF0254 GUK1 "Uncharacterized protein" 0.661 0.460 0.566 7.7e-32
UNIPROTKB|B1ANH0217 GUK1 "Guanylate kinase" [Homo 0.768 0.626 0.496 2.6e-31
UNIPROTKB|E1C038 GUK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 377 (137.8 bits), Expect = 8.3e-35, P = 8.3e-35
 Identities = 71/121 (58%), Positives = 93/121 (76%)

Query:     7 FQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTS 66
             F+DY + FGFSVSHTTR PRPGEV+GK YHFVTR +M++ I AGEF+EHAEF+ N+YGTS
Sbjct:    25 FKDYENIFGFSVSHTTRQPRPGEVNGKDYHFVTREEMKKEIDAGEFIEHAEFSGNMYGTS 84

Query:    67 RAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTET 126
             + AV+AV    + C+LDI++QGV+ +K+        +Y+ V+PPSI+ LE RLR R TET
Sbjct:    85 KGAVQAVQAKNQICILDIDIQGVKNIKKTD---LNPIYISVQPPSIDVLEKRLRDRQTET 141

Query:   127 E 127
             E
Sbjct:   142 E 142
GO:0006163 "purine nucleotide metabolic process" evidence=IEA
GO:0004385 "guanylate kinase activity" evidence=IEA
MGI|MGI:95871 Guk1 "guanylate kinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5R9 LOC100513720 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P31006 GUK1 "Guanylate kinase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G8JKX7 GUK1 "Guanylate kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P46195 GUK1 "Guanylate kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1309638 Guk1 "guanylate kinase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTV0 Guk1 "Protein Guk1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTF0 GUK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B1ANH0 GUK1 "Guanylate kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5LYX1KGUA_STRT12, ., 7, ., 4, ., 80.44520.75700.6411yesN/A
Q8EJU6KGUA_SHEON2, ., 7, ., 4, ., 80.44680.77960.6666yesN/A
Q8XJK8KGUA_CLOPE2, ., 7, ., 4, ., 80.42750.75700.6203yesN/A
Q9CEE3KGUA_LACLA2, ., 7, ., 4, ., 80.46150.71750.6195yesN/A
Q5N570KGUA_SYNP62, ., 7, ., 4, ., 80.42670.86440.8360yesN/A
Q64520KGUA_MOUSE2, ., 7, ., 4, ., 80.56020.77960.6969yesN/A
Q0HZX1KGUA_SHESR2, ., 7, ., 4, ., 80.43970.77960.6666yesN/A
Q2W9C3KGUA_MAGSA2, ., 7, ., 4, ., 80.50760.72310.5981yesN/A
Q24TX4KGUA_DESHY2, ., 7, ., 4, ., 80.45310.70620.625yesN/A
Q8DMQ7KGUA_THEEB2, ., 7, ., 4, ., 80.43160.76270.7068yesN/A
P15454KGUA_YEAST2, ., 7, ., 4, ., 80.49280.77960.7379yesN/A
Q54XF2KGUA_DICDI2, ., 7, ., 4, ., 80.45580.75140.6584yesN/A
Q182S8KGUA_CLOD62, ., 7, ., 4, ., 80.44440.74570.6439yesN/A
Q827Q3KGUA_STRAW2, ., 7, ., 4, ., 80.46660.74010.6649yesN/A
Q12IL8KGUA_SHEDO2, ., 7, ., 4, ., 80.46370.76270.6521yesN/A
Q0TPK6KGUA_CLOP12, ., 7, ., 4, ., 80.43470.75700.6203yesN/A
Q3ALX6KGUA_SYNSC2, ., 7, ., 4, ., 80.47610.69490.6648yesN/A
Q3MD38KGUA_ANAVT2, ., 7, ., 4, ., 80.48520.74570.6633yesN/A
Q16774KGUA_HUMAN2, ., 7, ., 4, ., 80.53190.77960.7005yesN/A
Q110R6KGUA_TRIEI2, ., 7, ., 4, ., 80.45310.70620.6720yesN/A
P46195KGUA_BOVIN2, ., 7, ., 4, ., 80.55310.77960.6969yesN/A
Q5P3M0KGUA_AROAE2, ., 7, ., 4, ., 80.49210.70620.6127yesN/A
Q895Q5KGUA_CLOTE2, ., 7, ., 4, ., 80.41660.72880.6201yesN/A
Q0HE40KGUA_SHESM2, ., 7, ., 4, ., 80.43970.77960.6666yesN/A
Q0A5V3KGUA_ALHEH2, ., 7, ., 4, ., 80.48430.70620.6157yesN/A
Q1AVZ3KGUA_RUBXD2, ., 7, ., 4, ., 80.47280.71180.6596yesN/A
Q088T7KGUA_SHEFN2, ., 7, ., 4, ., 80.44200.76270.6521yesN/A
Q0SS73KGUA_CLOPS2, ., 7, ., 4, ., 80.43470.75700.6203yesN/A
P31006KGUA_PIG2, ., 7, ., 4, ., 80.54600.77960.6969yesN/A
Q7WZE5KGUA_SHEVD2, ., 7, ., 4, ., 80.44200.76270.6521yesN/A
Q2J840KGUA_FRASC2, ., 7, ., 4, ., 80.47610.69490.6684yesN/A
Q2YD10KGUA_NITMU2, ., 7, ., 4, ., 80.42740.72310.6095yesN/A
Q9P6I5KGUA_SCHPO2, ., 7, ., 4, ., 80.48570.77400.6782yesN/A
Q7U570KGUA_SYNPX2, ., 7, ., 4, ., 80.46820.69490.6758yesN/A
Q8Z0I7KGUA_NOSS12, ., 7, ., 4, ., 80.49260.74570.6633yesN/A
Q5QYH9KGUA_IDILO2, ., 7, ., 4, ., 80.44600.76270.6428yesN/A
Q31DP7KGUA_THICR2, ., 7, ., 4, ., 80.44270.72310.6243yesN/A
Q5M3I4KGUA_STRT22, ., 7, ., 4, ., 80.44520.75700.6411yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.921
4th Layer2.7.4.80.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
TIGR03263179 TIGR03263, guanyl_kin, guanylate kinase 1e-65
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 1e-64
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 8e-58
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transpo 3e-57
smart00072174 smart00072, GuKc, Guanylate kinase homologues 1e-54
PLN02772398 PLN02772, PLN02772, guanylate kinase 4e-54
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMP 1e-50
PRK14738206 PRK14738, gmk, guanylate kinase; Provisional 1e-35
PRK14737186 PRK14737, gmk, guanylate kinase; Provisional 1e-30
>gnl|CDD|213788 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information 
 Score =  198 bits (506), Expect = 1e-65
 Identities = 65/132 (49%), Positives = 91/132 (68%), Gaps = 3/132 (2%)

Query: 12  DRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVE 71
               FS+S TTR PRPGEVDG  Y FV++ + EE I AGEFLE AE   N YGT ++ VE
Sbjct: 25  PNLKFSISATTRKPRPGEVDGVDYFFVSKEEFEEMIKAGEFLEWAEVHGNYYGTPKSPVE 84

Query: 72  AVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLR 131
             + +GK  +L+I+VQG +QVK+       AV +F+ PPS+EELE RLR RGT++E+ + 
Sbjct: 85  EALAAGKDVLLEIDVQGARQVKK---KFPDAVSIFILPPSLEELERRLRKRGTDSEEVIE 141

Query: 132 RRLDLARRDMSY 143
           RRL  A++++++
Sbjct: 142 RRLAKAKKEIAH 153

Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions]. Length = 179
>gnl|CDD|234719 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|223272 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|238026 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|237809 PRK14738, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 100.0
PRK14737186 gmk guanylate kinase; Provisional 100.0
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 100.0
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 100.0
PLN02772398 guanylate kinase 100.0
PRK14738206 gmk guanylate kinase; Provisional 100.0
KOG0707|consensus231 100.0
KOG0609|consensus542 100.0
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.96
PRK00300205 gmk guanylate kinase; Provisional 99.95
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 99.94
COG3709192 Uncharacterized component of phosphonate metabolis 99.83
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.79
KOG0708|consensus359 99.79
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 99.76
PRK08356195 hypothetical protein; Provisional 99.49
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 98.85
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 97.87
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 97.63
PRK00698205 tmk thymidylate kinase; Validated 97.08
KOG3209|consensus 984 96.99
PRK14731208 coaE dephospho-CoA kinase; Provisional 96.3
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.64
PRK04040188 adenylate kinase; Provisional 94.61
TIGR00152188 dephospho-CoA kinase. This model produces scores i 94.36
PRK00081194 coaE dephospho-CoA kinase; Reviewed 93.79
PHA02530 300 pseT polynucleotide kinase; Provisional 93.6
KOG3580|consensus 1027 93.29
PRK06762166 hypothetical protein; Provisional 93.04
PRK00098298 GTPase RsgA; Reviewed 92.95
PRK14530215 adenylate kinase; Provisional 92.26
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 90.97
PTZ00451244 dephospho-CoA kinase; Provisional 90.92
PRK14531183 adenylate kinase; Provisional 90.44
PRK12339197 2-phosphoglycerate kinase; Provisional 90.03
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 89.89
PLN02840 421 tRNA dimethylallyltransferase 89.78
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 88.6
PRK01184184 hypothetical protein; Provisional 88.05
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 87.73
PRK00279215 adk adenylate kinase; Reviewed 85.8
PRK14526211 adenylate kinase; Provisional 85.61
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 85.39
PRK14732196 coaE dephospho-CoA kinase; Provisional 85.23
PRK14527191 adenylate kinase; Provisional 84.85
PLN02422232 dephospho-CoA kinase 84.31
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 83.39
PRK14734200 coaE dephospho-CoA kinase; Provisional 83.37
COG1936180 Predicted nucleotide kinase (related to CMP and AM 81.8
PRK14528186 adenylate kinase; Provisional 81.46
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 81.41
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 81.09
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 80.61
PLN02674244 adenylate kinase 80.3
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=4.7e-50  Score=320.89  Aligned_cols=155  Identities=46%  Similarity=0.733  Sum_probs=148.9

Q ss_pred             HHHHHhhhCCCceeeeeeeecCCCCCCCCCCcceEeeCHHHHHHHHHcCCeEEEEEeCCceeeecHHHHHHHHhCCCeEE
Q psy9156           2 YSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCV   81 (177)
Q Consensus         2 l~~~Ll~~~p~~f~~~is~TTR~~R~gE~~G~dY~Fvs~~eF~~~i~~g~FlE~~~~~G~~YGt~~~~i~~~~~~gk~~i   81 (177)
                      |+++|++.+  .+.++||+|||+||+||+||+||||||+++|++++++|+||||++|+|||||||+..|+.++.+|++|+
T Consensus        20 l~k~L~~~~--~l~~SVS~TTR~pR~gEv~G~dY~Fvs~~EF~~~i~~~~fLE~a~~~gnyYGT~~~~ve~~~~~G~~vi   97 (191)
T COG0194          20 LVKALLEDD--KLRFSVSATTRKPRPGEVDGVDYFFVTEEEFEELIERDEFLEWAEYHGNYYGTSREPVEQALAEGKDVI   97 (191)
T ss_pred             HHHHHHhhc--CeEEEEEeccCCCCCCCcCCceeEeCCHHHHHHHHhcCCcEEEEEEcCCcccCcHHHHHHHHhcCCeEE
Confidence            688999987  599999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecHHHHHHHHHHcCCCCceEEEEEcCCCHHHHHHHHhhcCCCCHHHHHHHHHHHHHHhhhcchhhhhhcccccchhhh
Q psy9156          82 LDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGKNSLRSYVE  161 (177)
Q Consensus        82 l~id~~G~~~lk~~~~~~~~~~~IfI~pps~~~L~~RL~~Rg~es~e~I~~RL~~a~~e~~~~~~~~~~~~~~~~~~~~~  161 (177)
                      +++|+||++++|+.+   +++++|||.|||+++|++||.+||+++++.|++||.+|..||++.+.+++.+.|+++..=+.
T Consensus        98 ldId~qGa~qvk~~~---p~~v~IFi~pPs~eeL~~RL~~Rgtds~e~I~~Rl~~a~~Ei~~~~~fdyvivNdd~e~a~~  174 (191)
T COG0194          98 LDIDVQGALQVKKKM---PNAVSIFILPPSLEELERRLKGRGTDSEEVIARRLENAKKEISHADEFDYVIVNDDLEKALE  174 (191)
T ss_pred             EEEehHHHHHHHHhC---CCeEEEEEcCCCHHHHHHHHHccCCCCHHHHHHHHHHHHHHHHHHHhCCEEEECccHHHHHH
Confidence            999999999999999   79999999999999999999999999999999999999999999999999999988765443

>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
1lvg_A198 Crystal Structure Of Mouse Guanylate Kinase In Comp 7e-37
1gky_A187 Refined Structure Of The Complex Between Guanylate 2e-32
1ex6_A186 Crystal Structure Of Unliganded Form Of Guanylate K 2e-32
4f4j_A202 Conversion Of The Enzyme Guanylate Kinase Into A Mi 6e-32
2an9_A207 Crystal Structure Of Oligomeric E.Coli Guanylate Ki 6e-26
1s96_A219 The 2.0 A X-Ray Structure Of Guanylate Kinase From 5e-25
2qor_A204 Crystal Structure Of Plasmodium Vivax Guanylate Kin 2e-23
1z6g_A218 Crystal Structure Of Guanylate Kinase From Plasmodi 2e-21
2j41_A207 Crystal Structure Of Staphylococcus Aureus Guanylat 4e-21
3tau_A208 Crystal Structure Of A Putative Guanylate Monophosp 1e-20
1s4q_A228 Crystal Structure Of Guanylate Kinase From Mycobact 1e-19
1znw_A207 Crystal Structure Of Unliganded Form Of Mycobacteri 1e-19
3uat_A296 Guanylate Kinase Domains Of The Maguk Family Scaffo 4e-19
3tvt_A292 Structural Basis For Discs Large Interaction With P 5e-19
1z8f_A228 Guanylate Kinase Double Mutant A58c, T157c From Myc 8e-19
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 1e-18
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 1e-18
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 3e-18
3ney_A197 Crystal Structure Of The Kinase Domain Of Mpp1P55 L 7e-15
3lnc_A231 Crystal Structure Of Guanylate Kinase From Anaplasm 9e-15
3tr0_A205 Structure Of Guanylate Kinase (Gmk) From Coxiella B 1e-14
1kgd_A180 Crystal Structure Of The Guanylate Kinase-Like Doma 2e-13
>pdb|1LVG|A Chain A, Crystal Structure Of Mouse Guanylate Kinase In Complex With Gmp And Adp Length = 198 Back     alignment and structure 
Iteration: 1

 Score =  149 bits (376), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (73%), Gaps = 3/122 (2%)
Query: 6   FFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGT 65
            FQ++   FGFSVSHTTR PRPGE DGK Y+FVTR  M+  IAAG+F+EHAEF+ NLYGT
Sbjct: 24  LFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGT 83
Query: 66  SRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTE 125
           S+ AV AV    + CVLD+++QGV+ +K+        +Y+FV+PPS++ LE RLR R TE
Sbjct: 84  SKEAVRAVQAMNRICVLDVDLQGVRSIKKTD---LCPIYIFVQPPSLDVLEQRLRLRNTE 140
Query: 126 TE 127
           TE
Sbjct: 141 TE 142
>pdb|1GKY|A Chain A, Refined Structure Of The Complex Between Guanylate Kinase And Its Substrate Gmp At 2.0 Angstroms Resolution Length = 187 Back     alignment and structure
>pdb|1EX6|A Chain A, Crystal Structure Of Unliganded Form Of Guanylate Kinase From Yeast Length = 186 Back     alignment and structure
>pdb|4F4J|A Chain A, Conversion Of The Enzyme Guanylate Kinase Into A Mitotic Spindle Orienting Protein By A Single Mutation That Inhibits Gmp- Induced Closing Length = 202 Back     alignment and structure
>pdb|2AN9|A Chain A, Crystal Structure Of Oligomeric E.Coli Guanylate Kinase In Complex With Gdp Length = 207 Back     alignment and structure
>pdb|1S96|A Chain A, The 2.0 A X-Ray Structure Of Guanylate Kinase From E.Coli Length = 219 Back     alignment and structure
>pdb|2QOR|A Chain A, Crystal Structure Of Plasmodium Vivax Guanylate Kinase Length = 204 Back     alignment and structure
>pdb|1Z6G|A Chain A, Crystal Structure Of Guanylate Kinase From Plasmodium Falciparum Length = 218 Back     alignment and structure
>pdb|2J41|A Chain A, Crystal Structure Of Staphylococcus Aureus Guanylate Monophosphate Kinase Length = 207 Back     alignment and structure
>pdb|3TAU|A Chain A, Crystal Structure Of A Putative Guanylate Monophosphaste Kinase From Listeria Monocytogenes Egd-E Length = 208 Back     alignment and structure
>pdb|1S4Q|A Chain A, Crystal Structure Of Guanylate Kinase From Mycobacterium Tuberculosis (Rv1389) Length = 228 Back     alignment and structure
>pdb|1ZNW|A Chain A, Crystal Structure Of Unliganded Form Of Mycobacterium Tuberculosis Guanylate Kinase Length = 207 Back     alignment and structure
>pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 Back     alignment and structure
>pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 Back     alignment and structure
>pdb|1Z8F|A Chain A, Guanylate Kinase Double Mutant A58c, T157c From Mycobacterium Tuberculosis (Rv1389) Length = 228 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|3NEY|A Chain A, Crystal Structure Of The Kinase Domain Of Mpp1P55 Length = 197 Back     alignment and structure
>pdb|3LNC|A Chain A, Crystal Structure Of Guanylate Kinase From Anaplasma Phagocytophilum Length = 231 Back     alignment and structure
>pdb|3TR0|A Chain A, Structure Of Guanylate Kinase (Gmk) From Coxiella Burnetii Length = 205 Back     alignment and structure
>pdb|1KGD|A Chain A, Crystal Structure Of The Guanylate Kinase-Like Domain Of Human Cask Length = 180 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 5e-77
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 6e-76
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 8e-75
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 1e-74
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 8e-73
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 5e-72
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 2e-67
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 3e-66
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 4e-65
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 1e-63
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 8e-63
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 8e-62
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 3e-60
1kjw_A295 Postsynaptic density protein 95; protein-protein i 5e-58
2xkx_A721 Disks large homolog 4; structural protein, scaffol 3e-44
4dey_A337 Voltage-dependent L-type calcium channel subunit; 1e-30
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 3e-17
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-16
3kfv_A308 Tight junction protein ZO-3; structural genomics c 7e-15
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Length = 198 Back     alignment and structure
 Score =  227 bits (581), Expect = 5e-77
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 3/141 (2%)

Query: 7   FQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTS 66
           FQ++   FGFSVSHTTR PRPGE DGK Y+FVTR  M+  IAAG+F+EHAEF+ NLYGTS
Sbjct: 25  FQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTS 84

Query: 67  RAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTET 126
           + AV AV    + CVLD+++QGV+ +K+        +Y+FV+PPS++ LE RLR R TET
Sbjct: 85  KEAVRAVQAMNRICVLDVDLQGVRSIKK---TDLCPIYIFVQPPSLDVLEQRLRLRNTET 141

Query: 127 EDSLRRRLDLARRDMSYGKDS 147
           E+SL +RL  AR DM   K+ 
Sbjct: 142 EESLAKRLAAARTDMESSKEP 162
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Length = 204 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Length = 218 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Length = 207 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Length = 208 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Length = 207 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Length = 219 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Length = 205 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Length = 231 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 100.0
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 100.0
1kjw_A295 Postsynaptic density protein 95; protein-protein i 100.0
2xkx_A721 Disks large homolog 4; structural protein, scaffol 100.0
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 100.0
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 99.98
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 99.97
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.97
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.96
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 99.95
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.94
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.93
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.92
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.88
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.87
3kfv_A308 Tight junction protein ZO-3; structural genomics c 99.83
4dey_A337 Voltage-dependent L-type calcium channel subunit; 99.79
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.78
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 99.78
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.44
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 98.62
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 98.4
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 97.77
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.6
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.37
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.27
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 97.11
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.07
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.73
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.66
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.64
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.15
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.0
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.85
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.63
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 95.6
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.6
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.22
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 94.9
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.84
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.75
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 93.09
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.08
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 93.06
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.98
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.02
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 91.68
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 91.53
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 90.95
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 90.92
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 90.75
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 90.2
2vli_A183 Antibiotic resistance protein; transferase, tunica 89.47
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 89.21
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 89.06
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 88.58
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 87.71
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 86.97
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 86.94
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 86.3
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 85.75
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 85.44
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 84.45
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 83.72
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 82.64
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 82.3
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
Probab=100.00  E-value=1.9e-48  Score=311.92  Aligned_cols=155  Identities=45%  Similarity=0.806  Sum_probs=144.6

Q ss_pred             HHHHHhhhCCCceeeeeeeecCCCCCCCCCCcceEeeCHHHHHHHHHcCCeEEEEEeCCceeeecHHHHHHHHhCCCeEE
Q psy9156           2 YSILFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTCV   81 (177)
Q Consensus         2 l~~~Ll~~~p~~f~~~is~TTR~~R~gE~~G~dY~Fvs~~eF~~~i~~g~FlE~~~~~G~~YGt~~~~i~~~~~~gk~~i   81 (177)
                      |+++|++++|+.|.+++||||||||+||++|+||||||+++|++|+++|+|+|||+++||+|||++++|+.++++|++||
T Consensus        17 l~~~L~~~~~~~~~~svs~TTR~pR~gE~~G~dY~Fvs~~eF~~~i~~g~flE~~~~~g~~YGt~~~~v~~~l~~g~~vi   96 (186)
T 1ex7_A           17 LLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCI   96 (186)
T ss_dssp             HHHHHHHHCTTTEEECCCEECSCCCTTCCBTTTBEECCHHHHHHHHHTTCEEEEEEETTEEEEEEHHHHHHHHHHTSEEE
T ss_pred             HHHHHHHhCCCCeEEEEEEeccCCCCCCcCCceeEeecHHHHHHHHHcCCEEEEEEEcCceeeeecceeeehhhCCCEEE
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecHHHHHHHHHHcCCCCceEEEEEcCCCHHHHHHHHhhcCCCCHHHHHHHHHHHHHHhhhcchh--hhhhcccccch
Q psy9156          82 LDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDS--LRSYGKNSLRS  158 (177)
Q Consensus        82 l~id~~G~~~lk~~~~~~~~~~~IfI~pps~~~L~~RL~~Rg~es~e~I~~RL~~a~~e~~~~~~~--~~~~~~~~~~~  158 (177)
                      +++|++|++++++.++  .++++|||.|||.++|++||.+||++++++|++||++|+.||+++..+  +....|+++..
T Consensus        97 l~id~~g~~~~k~~~~--~~~~~Ifi~pps~e~L~~RL~~Rg~e~~e~i~~Rl~~a~~e~~~~~~~~fD~vIvNddle~  173 (186)
T 1ex7_A           97 LDIDMQGVKSVKAIPE--LNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDK  173 (186)
T ss_dssp             EECCHHHHHHHHTCGG--GCCEEEEEECSCHHHHHHHHHHHCCSCHHHHHHHHHHHHHHHHHHTTTCSSEEEECSSHHH
T ss_pred             ecCCHHHHHHHHHhcc--cCceEEEEeCCCHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHhhccccCCcEEEECcCHHH
Confidence            9999999999998764  589999999999999999999999999999999999999999887654  44446766544
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d1s96a_205 c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ 9e-22
d1gkya_186 c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Sac 5e-20
d1lvga_190 c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculu 5e-19
d1kjwa2199 c.37.1.1 (A:526-724) Guanylate kinase-like domain 7e-19
d1kgda_178 c.37.1.1 (A:) Guanylate kinase-like domain of Cask 4e-16
d1znwa1182 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu 1e-11
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 8e-05
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Escherichia coli [TaxId: 562]

 Score = 85.3 bits (210), Expect = 9e-22
 Identities = 62/142 (43%), Positives = 85/142 (59%), Gaps = 3/142 (2%)

Query: 5   LFFQDYPDRFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYG 64
           L           SVSHTTR PRPGEV G+ Y FV   + +E I+   FLEHAE   N YG
Sbjct: 22  LLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYG 81

Query: 65  TSRAAVEAVINSGKTCVLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGT 124
           TSR A+E V+ +G    LDI+ QG QQ+++    M  A  +F+ PPS  EL+ RLRGRG 
Sbjct: 82  TSREAIEQVLATGVDVFLDIDWQGAQQIRQ---KMPHARSIFILPPSKIELDRRLRGRGQ 138

Query: 125 ETEDSLRRRLDLARRDMSYGKD 146
           ++E+ + +R+  A  +MS+  +
Sbjct: 139 DSEEVIAKRMAQAVAEMSHYAE 160
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 186 Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 199 Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 100.0
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 100.0
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 100.0
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 100.0
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 100.0
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 100.0
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.86
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.85
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 84.65
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 84.41
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 82.18
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 81.54
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 81.45
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.6e-45  Score=296.11  Aligned_cols=154  Identities=40%  Similarity=0.604  Sum_probs=147.3

Q ss_pred             HHHHHhhhCCC-ceeeeeeeecCCCCCCCCCCcceEeeCHHHHHHHHHcCCeEEEEEeCCceeeecHHHHHHHHhCCCeE
Q psy9156           2 YSILFFQDYPD-RFGFSVSHTTRGPRPGEVDGKAYHFVTRADMEERIAAGEFLEHAEFAANLYGTSRAAVEAVINSGKTC   80 (177)
Q Consensus         2 l~~~Ll~~~p~-~f~~~is~TTR~~R~gE~~G~dY~Fvs~~eF~~~i~~g~FlE~~~~~G~~YGt~~~~i~~~~~~gk~~   80 (177)
                      |+++|++.+|. .|.+++||||||||+||++|+||||||+++|++|+++|+|+|||+++||+|||++++|..++++|++|
T Consensus        18 l~~~L~~~~p~~~~~~~is~TTR~~R~~E~~G~dY~Fvs~~~F~~~i~~g~flE~~~~~g~~YGt~~~~v~~~~~~g~~~   97 (205)
T d1s96a_          18 LIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDV   97 (205)
T ss_dssp             HHHHHHHHSCTTTEEECCCEECSCCCTTCCBTTTBEECCHHHHHHHHHTTCEEEEEEETTEEEEEEHHHHHHHHTTTCEE
T ss_pred             HHHHHHhhCCccCceEEEEEeccCCCccccccccceeecHHHHHHHhhhhhheeEEEECCceeccccchHHHHHhcCCce
Confidence            67899999995 59999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecHHHHHHHHHHcCCCCceEEEEEcCCCHHHHHHHHhhcCCCCHHHHHHHHHHHHHHhhhcchhhhhhcccccch
Q psy9156          81 VLDIEVQGVQQVKRAGGAMAGAVYVFVKPPSIEELETRLRGRGTETEDSLRRRLDLARRDMSYGKDSLRSYGKNSLRS  158 (177)
Q Consensus        81 il~id~~G~~~lk~~~~~~~~~~~IfI~pps~~~L~~RL~~Rg~es~e~I~~RL~~a~~e~~~~~~~~~~~~~~~~~~  158 (177)
                      |+++|++|+.++++.+   +.+++|||.|||.++|++||.+||+++++.|++|+.+|..|+.+.+.++....|+++..
T Consensus        98 ildid~~g~~~lk~~~---~~~~~ifi~pps~~~l~~RL~~Rg~~~~~~i~~Rl~~a~~E~~~~~~fD~vIvNddl~~  172 (205)
T d1s96a_          98 FLDIDWQGAQQIRQKM---PHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDT  172 (205)
T ss_dssp             EEECCHHHHHHHHHHC---TTCEEEEEECSSHHHHHHHHHTTSCSCHHHHHHHHHHHHHHHTTGGGSSEEEECSSHHH
T ss_pred             eecCcHHHHHHHHhhh---cccceeeeeccchHHHHHHHHhcCCchHHHHHHHHHHHHHHHHHHhCCCEEEECcCHHH
Confidence            9999999999999999   78999999999999999999999999999999999999999999998888888887654
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure