Diaphorina citri psyllid: psy9160

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------
MSTPAASAPELSSLFDKNRSLAYIMLLFQVPPNHGPHHGQSGYHHQEEDTGNSNPELAKYLDRSYWEQKKVPPNHGSHHGQSGYHHQEEDTGNSNPELAKYLDRSYWEQKKYGTHGSHYSTDHHMNHTSGVTSPDEASDTELDDFIRALKSQVEIFVNRMKSNSSRGRSIANDSSVQTLFVNITTMHSRLLKYIQQKDDKRVYYEGLQDKLTQVKDARAALNALREEHNEKLRREAQIAERQKQIQMAHKLDLMRKKKQEYLQYQRNLALQKIQEQEYEMQRRQEQQKQYYMQNNVA
cccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHcccHHHHHccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*****************NRSLAYIMLLFQV****************************KYL***************************************YLDRSYWE************************************FIRALKSQVEIFV*****************SVQTLFVNITTMHSRLLKYIQQKDDKRVYYEGLQDKLTQVKDA**ALN*****************************************Y*********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTPAASAPELSSLFDKNRSLAYIMLLFQVPPNHGPHHGQSGYHHQEEDTGNSNPELAKYLDRSYWEQKKVPPNHGSHHGQSGYHHQEEDTGNSNPELAKYLDRSYWEQKKYGTHGSHYSTDHHMNHTSGVTSPDEASDTELDDFIRALKSQVEIFVNRMKSNSSRGRSIANDSSVQTLFVNITTMHSRLLKYIQQKDDKRVYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLDLMRKKKQEYLQYQRNLALQKIQEQEYEMQRRQEQQKQYYMQNNVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0008333 [BP]endosome to lysosome transportprobableGO:0016197, GO:0051234, GO:0046907, GO:0007034, GO:0006810, GO:0044765, GO:0008150, GO:0007041, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0033565 [CC]ESCRT-0 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005575, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016020 [CC]membraneprobableGO:0005575
GO:0046426 [BP]negative regulation of JAK-STAT cascadeprobableGO:0009968, GO:0046425, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0010627, GO:0010741, GO:0048523
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F1I, chain H
Confidence level:very confident
Coverage over the Query: 141-238
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 220-294
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2d3g, chain Pprobable Alignment | Template Structure