Diaphorina citri psyllid: psy9170


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MYDYDEIQAFLEMADECAASTMVTYFTTCVAQLRGRAVYVQFSNHKELKTDQTHSNALLLHLTIGIILRPATHYQVHLIRSACQVYLIVCVLIR
cccccccEEEEEcccHHHHHHHHHHHHccccEEcccEEEEEEccccccccccccccHHHHHHHHHHcccccHHHHHHHHcccccEEEEEEEEEc
***YDEIQAFLEMADECAASTMVTYFTTCVAQLRGRAVYVQFSNHKELKTDQTHSNALLLHLTIGIILRPATHYQVHLIRSACQVYLIVCVLIR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDYDEIQAFLEMADECAASTMVTYFTTCVAQLRGRAVYVQFSNHKELKTDQTHSNALLLHLTIGIILRPATHYQVHLIRSACQVYLIVCVLIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polypyrimidine tract-binding protein 1 Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10.confidentQ8WN55
Polypyrimidine tract-binding protein 1 Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10.confidentQ00438
Polypyrimidine tract-binding protein 1 Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10.confidentP26599

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008380 [BP]RNA splicingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0036002 [MF]pre-mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0003730 [MF]mRNA 3'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0000381 [BP]regulation of alternative mRNA splicing, via spliceosomeprobableGO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0048024, GO:0008150, GO:0010468
GO:0048025 [BP]negative regulation of mRNA splicing, via spliceosomeprobableGO:0033119, GO:0009892, GO:0080090, GO:0019222, GO:0050684, GO:0050686, GO:0031323, GO:0048024, GO:0050789, GO:0010605, GO:0043484, GO:0019219, GO:0065007, GO:0048519, GO:0010468, GO:0031324, GO:0045934, GO:0060255, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:0051253, GO:0051252, GO:0048523
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0051148 [BP]negative regulation of muscle cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0051147, GO:0048519, GO:0050789, GO:0048523
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0005681 [CC]spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AD9, chain A
Confidence level:very confident
Coverage over the Query: 4-55
View the alignment between query and template
View the model in PyMOL
Template: 3TYT, chain A
Confidence level:confident
Coverage over the Query: 5-86
View the alignment between query and template
View the model in PyMOL