Diaphorina citri psyllid: psy9171


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MKDIGGNVKYTLVMVVQAKLDRQKSDFKPSRVIHIRNIPNEVTEAEIIHLGIPFGRVTNVLVLKGKNQLLLHLEAEIIHLGIPFGRVTNVLVLKGKNQVSLISGYRNRQSAALMMIIK
cccccccccEEEEEEEEEccccccccccccEEEEEccccccccHHHHHHHcccccEEEEEEEEccccEEEEEccHHHHHHHccEEEEEccEEEccEEEEEEEccccEEcccccEEEcc
******NVKYTLVMVVQAKLDRQKSDFKPSRVIHIRNIPNEVTEAEIIHLGIPFGRVTNVLVLKGKNQLLLHLEAEIIHLGIPFGRVTNVLVLKGKNQVSLISGYRNR**A**MMIIK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDIGGNVKYTLVMVVQAKLDRQKSDFKPSRVIHIRNIPNEVTEAEIIHLGIPFGRVTNVLVLKGKNQLLLHLEAEIIHLGIPFGRVTNVLVLKGKNQVSLISGYRNRQSAALMMIIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polypyrimidine tract-binding protein 2 RNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing. May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection. Beside its function in pre-mRNA splicing, plays also a role in the regulation of translation. Isoform 5 has a reduced affinity for RNA.confidentQ9UKA9
Polypyrimidine tract-binding protein 2 RNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing. May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection. Beside its function in pre-mRNA splicing, plays also a role in the regulation of translation.confidentQ91Z31
Polypyrimidine tract-binding protein 2 RNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing. May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection. Beside its function in pre-mRNA splicing, plays also a role in the regulation of translation.confidentQ66H20

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0033119 [BP]negative regulation of RNA splicingprobableGO:0051252, GO:0010605, GO:0045934, GO:0019222, GO:0008150, GO:0060255, GO:0031323, GO:0051253, GO:0043484, GO:0031324, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0051172, GO:0048519, GO:0009892, GO:0010468, GO:0048523, GO:0080090

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CQ1, chain A
Confidence level:very confident
Coverage over the Query: 25-108
View the alignment between query and template
View the model in PyMOL
Template: 2ADC, chain A
Confidence level:confident
Coverage over the Query: 5-106
View the alignment between query and template
View the model in PyMOL