Diaphorina citri psyllid: psy9172

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MNSASAQAALQAAQALTGQTDTQGGPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELAGFRSEATEFS
ccHHHHHHHHHHHHHHccccccccccccEEEEEEEccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccc
**************************NTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELA**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSASAQAALQAAQALTGQTDTQGGPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELAGFRSEATEFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0003730 [MF]mRNA 3'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SJR, chain A
Confidence level:very confident
Coverage over the Query: 26-62
View the alignment between query and template
View the model in PyMOL