Psyllid ID: psy9172


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MNSASAQAALQAAQALTGQTDTQGGPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELAGFRSEATEFS
ccHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccccc
ccccHHHHHHHHccccccccccccccccHHHEEHHHccccEEHHHHHHHHHccccccccccccccHHHHccccccccccc
MNSASAQAALQAAQALtgqtdtqggpnTVLRVIIEHMLYPITLdvlyqfdnykfghafstslamprdelagfrseatefs
MNSASAQAALQAAQaltgqtdtqggPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELAGFRSEATEFS
MNsasaqaalqaaqalTGQTDTQGGPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELAGFRSEATEFS
**************************NTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSL******************
*****************************LRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELAGF*S******
********************DTQGGPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELA**********
*************************PNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSL******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSASAQAALQAAQALTGQTDTQGGPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELAGFRSEATEFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
322802943114 hypothetical protein SINV_16070 [Solenop 0.575 0.403 0.586 3e-09
321470924 540 hypothetical protein DAPPUDRAFT_302853 [ 0.4 0.059 0.812 4e-09
242023546 513 Polypyrimidine tract-binding protein, pu 0.387 0.060 0.838 1e-08
328712476 581 PREDICTED: polypyrimidine tract-binding 0.4 0.055 0.75 4e-08
328712478 613 PREDICTED: polypyrimidine tract-binding 0.4 0.052 0.75 5e-08
328712480 632 PREDICTED: polypyrimidine tract-binding 0.4 0.050 0.75 5e-08
307694571 181 hephaestus [Biston betularia] 0.487 0.215 0.725 7e-08
345496639 587 PREDICTED: polypyrimidine tract-binding 0.562 0.076 0.604 8e-08
357623431 621 putative polypyrimidine tract binding pr 0.425 0.054 0.8 1e-07
328788959 449 PREDICTED: polypyrimidine tract-binding 0.612 0.109 0.56 2e-07
>gi|322802943|gb|EFZ23084.1| hypothetical protein SINV_16070 [Solenopsis invicta] Back     alignment and taxonomy information
 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 37/46 (80%)

Query: 3   SASAQAALQAAQALTGQTDTQGGPNTVLRVIIEHMLYPITLDVLYQ 48
           +++ Q A+     ++G  +TQGGPNTVLRVI+EH+LYPITLD+LYQ
Sbjct: 68  NSNNQVAIAGQNQVSGAGETQGGPNTVLRVIVEHLLYPITLDILYQ 113




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321470924|gb|EFX81898.1| hypothetical protein DAPPUDRAFT_302853 [Daphnia pulex] Back     alignment and taxonomy information
>gi|242023546|ref|XP_002432193.1| Polypyrimidine tract-binding protein, putative [Pediculus humanus corporis] gi|212517590|gb|EEB19455.1| Polypyrimidine tract-binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328712476|ref|XP_003244820.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328712478|ref|XP_001947870.2| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328712480|ref|XP_003244821.1| PREDICTED: polypyrimidine tract-binding protein 1-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307694571|gb|ADN84938.1| hephaestus [Biston betularia] Back     alignment and taxonomy information
>gi|345496639|ref|XP_001603240.2| PREDICTED: polypyrimidine tract-binding protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357623431|gb|EHJ74585.1| putative polypyrimidine tract binding protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|328788959|ref|XP_625087.3| PREDICTED: polypyrimidine tract-binding protein 2 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
FB|FBgn0011224 789 heph "hephaestus" [Drosophila 0.437 0.044 0.583 3.4e-06
ZFIN|ZDB-GENE-030131-9796 586 ptbp1b "polypyrimidine tract b 0.462 0.063 0.55 0.00015
WB|WBGene00004207 615 ptb-1 [Caenorhabditis elegans 0.425 0.055 0.571 0.00016
UNIPROTKB|K7ES59209 PTBP1 "Polypyrimidine tract-bi 0.375 0.143 0.548 0.00072
UNIPROTKB|K7EKJ7236 PTBP1 "Polypyrimidine tract-bi 0.375 0.127 0.548 0.00094
UNIPROTKB|C9JJZ7149 HNRPLL "Heterogeneous nuclear 0.425 0.228 0.529 0.00097
FB|FBgn0011224 heph "hephaestus" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 119 (46.9 bits), Expect = 3.4e-06, P = 3.4e-06
 Identities = 21/36 (58%), Positives = 29/36 (80%)

Query:    18 GQTDTQGGPNTVLRVIIEHMLYPITLDVLYQ-FDNY 52
             G T+  GGPNTVLRVI+E ++YP++LD+L+Q F  Y
Sbjct:   394 GNTNAAGGPNTVLRVIVESLMYPVSLDILHQIFQRY 429




GO:0007286 "spermatid development" evidence=IMP
GO:0008187 "poly-pyrimidine tract binding" evidence=ISS;NAS
GO:0003729 "mRNA binding" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=ISS
GO:0007219 "Notch signaling pathway" evidence=IMP
GO:0008586 "imaginal disc-derived wing vein morphogenesis" evidence=IMP
GO:0008587 "imaginal disc-derived wing margin morphogenesis" evidence=IMP
GO:0005634 "nucleus" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0007319 "negative regulation of oskar mRNA translation" evidence=IMP
GO:0008103 "oocyte microtubule cytoskeleton polarization" evidence=IMP
GO:0003730 "mRNA 3'-UTR binding" evidence=IDA
GO:0000900 "translation repressor activity, nucleic acid binding" evidence=IMP
GO:0030529 "ribonucleoprotein complex" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:2001020 "regulation of response to DNA damage stimulus" evidence=IGI
GO:0006974 "response to DNA damage stimulus" evidence=IMP
GO:0007291 "sperm individualization" evidence=IMP
ZFIN|ZDB-GENE-030131-9796 ptbp1b "polypyrimidine tract binding protein 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00004207 ptb-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|K7ES59 PTBP1 "Polypyrimidine tract-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EKJ7 PTBP1 "Polypyrimidine tract-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JJZ7 HNRPLL "Heterogeneous nuclear ribonucleoprotein L-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
TIGR01649 481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 2e-09
cd1269396 cd12693, RRM2_PTBP1_like, RNA recognition motif 2 5e-09
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 2e-06
cd1269288 cd12692, RRM2_PTBPH3, RNA recognition motif 2 in p 3e-05
cd12783101 cd12783, RRM2_PTBP2, RNA recognition motif 2 in ve 2e-04
cd12784103 cd12784, RRM2_ROD1, RNA recognition motif 2 in ver 4e-04
cd12782100 cd12782, RRM2_PTBP1, RNA recognition motif 2 in ve 4e-04
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
 Score = 51.4 bits (123), Expect = 2e-09
 Identities = 20/33 (60%), Positives = 23/33 (69%)

Query: 19  QTDTQGGPNTVLRVIIEHMLYPITLDVLYQFDN 51
                 GPN VLRVI+E+ +YPITLDVLYQ  N
Sbjct: 86  SDFDSAGPNKVLRVIVENPMYPITLDVLYQIFN 118


Included in this family of heterogeneous ribonucleoproteins are PTB (polypyrimidine tract binding protein ) and hnRNP-L. These proteins contain four RNA recognition motifs (rrm: pfam00067). Length = 481

>gnl|CDD|241137 cd12693, RRM2_PTBP1_like, RNA recognition motif 2 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241136 cd12692, RRM2_PTBPH3, RNA recognition motif 2 in plant polypyrimidine tract-binding protein homolog 3 (PTBPH3) Back     alignment and domain information
>gnl|CDD|241227 cd12783, RRM2_PTBP2, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) Back     alignment and domain information
>gnl|CDD|241228 cd12784, RRM2_ROD1, RNA recognition motif 2 in vertebrate regulator of differentiation 1 (Rod1) Back     alignment and domain information
>gnl|CDD|241226 cd12782, RRM2_PTBP1, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein 1 (PTB) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 80
KOG1190|consensus 492 99.76
KOG1456|consensus 494 98.86
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 97.64
KOG1190|consensus 492 96.58
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 90.88
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 88.69
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 86.77
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 84.11
smart0036272 RRM_2 RNA recognition motif. 82.88
KOG4207|consensus 256 81.16
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 80.79
>KOG1190|consensus Back     alignment and domain information
Probab=99.76  E-value=4e-19  Score=144.65  Aligned_cols=69  Identities=39%  Similarity=0.621  Sum_probs=61.3

Q ss_pred             ChHHHHHHHHHhhhhhcC----------CCCCCCCCcEEEEEEecccceeehhhhhhhhcccccceeeeceeeccccccC
Q psy9172           2 NSASAQAALQAAQALTGQ----------TDTQGGPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAMPRDELAG   71 (80)
Q Consensus         2 n~~~aqaALqa~n~v~~~----------~~~~~~pn~VLrviIeN~~YPVTldVLhqiFs~~fG~Vlrq~~a~~~~~~~~   71 (80)
                      ||.+++++++++++++..          ...+++||+|||+|||||+||||+|||||||| +||+|+   ++++|.|.+|
T Consensus       113 ~q~r~~~vy~~~s~~q~~~~~~s~~~~~~G~~~~~n~vLr~iie~m~ypVslDVLHqvFS-~fG~Vl---KIiTF~Knn~  188 (492)
T KOG1190|consen  113 NQIRGQAVYQAVSSVQEIVLPLSASAVVVGNEDGPNPVLRTIIENMFYPVSLDVLHQVFS-KFGFVL---KIITFTKNNG  188 (492)
T ss_pred             hhhhhhhHHhhhhcccccccccccccccccccCCCceeEEEEeccceeeeEHHHHHHHHh-hcceeE---EEEEEecccc
Confidence            567999999999876553          13677999999999999999999999999999 999999   8999999999


Q ss_pred             ccc
Q psy9172          72 FRS   74 (80)
Q Consensus        72 ~~~   74 (80)
                      |.-
T Consensus       189 FQA  191 (492)
T KOG1190|consen  189 FQA  191 (492)
T ss_pred             hhh
Confidence            963



>KOG1456|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
1sjr_A164 Nmr Structure Of Rrm2 From Human Polypyrimidine Tra 8e-04
>pdb|1SJR|A Chain A, Nmr Structure Of Rrm2 From Human Polypyrimidine Tract Binding Protein Isoform 1 (Ptb1) Length = 164 Back     alignment and structure

Iteration: 1

Score = 38.9 bits (89), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 17/32 (53%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Query: 24 GGPNTVLRVIIEHMLYPITLDVLYQFDNYKFG 55 G + VLR+I+E++ YP+TLDVL+Q + KFG Sbjct: 41 AGQSPVLRIIVENLFYPVTLDVLHQIFS-KFG 71

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 1e-07
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 1e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 2e-06
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
 Score = 44.2 bits (104), Expect = 1e-07
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 5  SAQAALQAAQALTGQTDTQGGPNTVLRVIIEHMLYPITLDVLYQ-FDNY 52
          S   AL A+ A         G + VLR+I+E++ YP+TLDVL+Q F  +
Sbjct: 4  SGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKF 52


>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.89
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.86
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.59
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 95.88
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 95.76
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 95.28
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 95.25
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 95.04
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 94.86
2krb_A81 Eukaryotic translation initiation factor 3 subunit 94.72
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 94.69
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 94.65
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 94.65
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 94.54
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 94.5
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 94.38
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 94.3
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 94.26
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 94.18
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 94.06
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 93.97
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 93.83
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 93.73
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 93.61
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 93.58
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 93.56
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 93.55
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 93.52
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 93.48
2cph_A107 RNA binding motif protein 19; RNA recognition moti 93.47
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 93.45
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 93.34
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 93.34
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 93.33
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 93.31
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 93.31
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 93.05
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 93.04
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 93.0
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 92.94
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 92.94
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 92.87
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 92.85
1x4e_A85 RNA binding motif, single-stranded interacting pro 92.82
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 92.81
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 92.79
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 92.72
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 92.7
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 92.7
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 92.68
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 92.63
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 92.6
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 92.56
2la6_A99 RNA-binding protein FUS; structural genomics, nort 92.48
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 92.47
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 92.44
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 92.44
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 92.43
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 92.42
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 92.41
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 92.37
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 92.33
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 92.24
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 92.22
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 92.2
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 92.15
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 92.14
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 92.08
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 92.03
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 91.9
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 91.9
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 91.87
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 91.87
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 91.83
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 91.82
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 91.8
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 91.75
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 91.75
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 91.69
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 91.63
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 91.61
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 91.57
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 91.54
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 91.53
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 91.32
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 91.31
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 91.18
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 91.16
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 91.15
2cqd_A116 RNA-binding region containing protein 1; RNA recog 90.97
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 90.92
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 90.92
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 90.88
1x5o_A114 RNA binding motif, single-stranded interacting pro 90.82
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 90.76
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 90.69
2cpj_A99 Non-POU domain-containing octamer-binding protein; 90.64
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 90.62
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 90.55
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 90.54
2dit_A112 HIV TAT specific factor 1 variant; structural geno 90.51
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 90.5
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 90.35
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 90.22
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 90.2
3p5t_L90 Cleavage and polyadenylation specificity factor S; 90.15
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 90.09
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 90.06
2dis_A109 Unnamed protein product; structural genomics, RRM 90.01
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 89.97
2dnl_A114 Cytoplasmic polyadenylation element binding protei 89.93
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 89.88
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 89.76
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 89.73
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 89.55
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 89.48
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 89.31
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 89.26
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 89.23
2div_A99 TRNA selenocysteine associated protein; structural 89.2
2cjk_A 167 Nuclear polyadenylated RNA-binding protein 4; HRP1 89.17
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 89.13
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 89.07
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 89.05
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 89.01
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 89.0
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 88.93
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 88.88
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 88.87
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 88.81
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 88.79
3nmr_A 175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 88.72
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 88.59
1x5p_A97 Negative elongation factor E; structure genomics, 88.48
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 88.46
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 88.38
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 88.36
3md3_A 166 Nuclear and cytoplasmic polyadenylated RNA-bindin 88.36
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 88.36
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 88.19
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 88.07
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 88.06
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 87.97
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 87.85
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 87.84
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 87.8
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 87.73
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 87.63
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 87.44
2i2y_A150 Fusion protein consists of immunoglobin G- binding 87.35
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 87.32
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 87.25
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 87.23
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 87.19
2kt5_A124 RNA and export factor-binding protein 2; chaperone 86.99
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 86.91
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 86.66
1b7f_A 168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 86.41
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 86.29
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 86.15
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 86.08
3n9u_C156 Cleavage and polyadenylation specificity factor S; 86.07
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 85.88
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 85.7
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 85.56
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 85.68
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 85.27
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 85.08
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 84.84
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 84.61
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 84.31
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 84.18
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 83.75
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 83.09
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 82.97
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 82.9
2f3j_A177 RNA and export factor binding protein 2; RRM domai 82.52
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 82.16
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 81.75
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 81.43
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 81.13
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 81.13
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 81.03
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 80.86
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 80.78
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
Probab=98.89  E-value=8.5e-10  Score=77.63  Aligned_cols=58  Identities=43%  Similarity=0.642  Sum_probs=35.5

Q ss_pred             HHHHHHHHHhhhhhcCC-------------CCCCCCCcEEEEEEecccceeehhhhhhhhcccccceeeece
Q psy9172           4 ASAQAALQAAQALTGQT-------------DTQGGPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSL   62 (80)
Q Consensus         4 ~~aqaALqa~n~v~~~~-------------~~~~~pn~VLrviIeN~~YPVTldVLhqiFs~~fG~Vlrq~~   62 (80)
                      -.||++++++++++++.             ..+.+|++||+|.|.|+-|+||-|.|+++|+ +||.|.+-.+
T Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ps~vl~l~VgNL~~~vted~L~~~Fs-~fG~V~~V~i   78 (164)
T 1sjr_A            8 GSAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFS-KFGTVLKIIT   78 (164)
T ss_dssp             --------------------------------CCCCCCEEEEEECSCCSCCCHHHHHHHHH-HHSCEEEEEE
T ss_pred             cchhHHHHHHHHhhcCCccccccccccccCCCCCCCCceEEEEEeCcCCCCCHHHHHHHHH-hcCCEEEEEE
Confidence            47899999998876641             2345789999999999999999999999999 9999986554



>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.62
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 96.31
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 95.71
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 95.56
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 94.95
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 94.81
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 94.57
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 94.53
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 94.4
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 94.22
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 94.0
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 93.85
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 93.22
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 93.1
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 92.87
d2cpja186 Non-POU domain-containing octamer-binding protein, 92.77
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 92.65
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 92.57
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 92.52
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 92.42
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 92.26
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 92.22
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 92.03
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 91.95
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 91.95
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 91.82
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 91.42
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 91.41
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 91.25
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 91.16
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 91.1
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 90.95
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 90.93
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 90.87
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 90.86
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 90.8
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 90.72
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 90.63
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 90.36
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 90.27
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 89.94
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 89.9
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 89.81
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 89.58
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 89.51
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 89.24
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 88.87
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 88.73
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 88.65
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 88.36
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 88.18
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 87.65
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 87.56
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 87.53
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 87.52
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 87.32
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 87.25
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 87.04
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 86.76
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 86.72
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 86.56
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 86.36
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 86.28
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 85.53
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 85.45
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 85.17
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 83.6
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 83.57
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 82.73
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 82.46
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 81.99
d1u1qa_ 183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 81.74
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 81.72
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 80.27
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Polypyrimidine tract-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.62  E-value=9.2e-09  Score=63.73  Aligned_cols=41  Identities=41%  Similarity=0.698  Sum_probs=36.7

Q ss_pred             CCCCCcEEEEEEecccceeehhhhhhhhcccccceeeeceee
Q psy9172          23 QGGPNTVLRVIIEHMLYPITLDVLYQFDNYKFGHAFSTSLAM   64 (80)
Q Consensus        23 ~~~pn~VLrviIeN~~YPVTldVLhqiFs~~fG~Vlrq~~a~   64 (80)
                      +.+|+++|||.|.|+-|.||-|-|+++|+ +||.|.+-++..
T Consensus         1 ~~~~s~~~~v~V~NL~~~vte~~L~~~F~-~~G~i~~~~i~~   41 (108)
T d2adba1           1 MAGQSPVLRIIVENLFYPVTLDVLHQIFS-KFGTVLKIITFT   41 (108)
T ss_dssp             SCCCCCEEEEESCSCCSTTHHHHHHHHHT-TTSCEEEEEEEE
T ss_pred             CCCCCCeEEEEEeCcCCCCCHHHHHHHHc-cCCcEEEEEEEe
Confidence            35789999999999999999999999999 999998766543



>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure