Diaphorina citri psyllid: psy9185


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MSNSDEQRQRGSGVIKENTSSMILVDSSDTEKLKTNPHLEILHNADLNFVKDESSSPSSSTLISSQCLPSSMTSGQISSSTLTVLHPMEYCYPPPPLSLPVLVEQSLVKYETPNTVTSTAPTPYSGANTTRCHRKISDSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSSTNTSYVYPLDDSCVDCGSAIGQWTQYAQR
ccccHHHHHcccccEEccccEEEEEcccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHccc
*********************MILVDS*************IL****************************************TVLHPMEYCYPPPPLSL**************************************************RERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSST*TSYVYPLDDSCVDCGSAIGQWTQY***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNSDEQRQRGSGVIKENTSSMILVDSSDTEKLKTNPHLEILHNADLNFVKDESSSPSSSTLISSQCLPSSMTSGQISSSTLTVLHPMEYCYPPPPLSLPVLVEQSLVKYETPNTVTSTAPTPYSGANTTRCHRKISDSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSSTNTSYVYPLDDSCVDCGSAIGQWTQYAQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051254 [BP]positive regulation of RNA metabolic processprobableGO:0045935, GO:0010604, GO:0019222, GO:0060255, GO:0031323, GO:0031325, GO:0051252, GO:0080090, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0051173, GO:0048518, GO:0008150, GO:0048522, GO:0050789, GO:0009893
GO:0010557 [BP]positive regulation of macromolecule biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0060255, GO:0009889, GO:0010556, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0010604
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0031328 [BP]positive regulation of cellular biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0009889, GO:0050794, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MDY, chain A
Confidence level:very confident
Coverage over the Query: 131-201
View the alignment between query and template
View the model in PyMOL