Psyllid ID: psy9185


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MSNSDEQRQRGSGVIKENTSSMILVDSSDTEKLKTNPHLEILHNADLNFVKDESSSPSSSTLISSQCLPSSMTSGQISSSTLTVLHPMEYCYPPPPLSLPVLVEQSLVKYETPNTVTSTAPTPYSGANTTRCHRKISDSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSSTNTSYVYPLDDSCVDCGSAIGQWTQYAQR
ccccHHHHHHccccEEccccEEEEEcccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHccc
ccccHHHHcccccEEEEcccEEEEEccccccEEEEcccHHHHccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccccHHHHHHHHccc
msnsdeqrqrgsgvikentssmilvdssdteklktnphleilhnadlnfvkdessspssstlissqclpssmtsgqissstltvlhpmeycypppplslpvlveqslvkyetpntvtstaptpysganttrchrkisdserdyKKTACDRERTRMRDMNRAFDLLrnrlppckppgkklsKIESLRMAIRYIRHLQCLLeygpeyetilyssrsvvpsstntsyvyplddscvdcgsAIGQWTQYAQR
msnsdeqrqrgsgvikentssmilvDSSDTEKLKTNPHLEILHNADLNFVKDESSSPSSSTLISSQCLPSSMTSGQISSSTLTVLHPMEYCYPPPPLSLPVLVEQSLVKYEtpntvtstaptpysganttrchrkisdserdykktacdrertrmrdmnrafdllrnrlppckppgkklskiESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSSTNTSYVYPLDDSCVDCGSAIGQWTQYAQR
MSNSDEQRQRGSGVIKENTSSMILVDSSDTEKLKTNPHLEILHNADLNFVKDEssspssstlissqclpssmtsgqisssTLTVLHPMEYCYpppplslpvlveqslvKYETPNTVTSTAPTPYSGANTTRCHRKISDSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSSTNTSYVYPLDDSCVDCGSAIGQWTQYAQR
****************************************IL***************************************LTVLHPMEYCYPPPPLSLPVLVEQSLVKYE*********************************************************************KIESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSSTNTSYVYPLDDSCVDCGSAIGQWTQY***
*********************MILVDS**************************************************************************************************************************RERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCL**************************************************
**************IKENTSSMILVDSSDTEKLKTNPHLEILHNADLNFV***************************SSSTLTVLHPMEYCYPPPPLSLPVLVEQSLVKYETPNTVTSTAPTPYSGANTTRCHRKISDSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSSTNTSYVYPLDDSCVDCGSAIGQWTQYAQR
***********SGVIKENTSSMILVDSSDTEKLKTNPHLEILHNADLNFVKDES****************************TVLHPMEYCYPPPPLSL***************************************************ERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSST*TSYVYPLDDSCVDCGSAIGQWTQYA**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNSDEQRQRGSGVIKENTSSMILVDSSDTEKLKTNPHLEILHNADLNFVKDESSSPSSSTLISSQCLPSSMTSGQISSSTLTVLHPMEYCYPPPPLSLPVLVEQSLVKYETPNTVTSTAPTPYSGANTTRCHRKISDSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYGPEYETILYSSRSVVPSSTNTSYVYPLDDSCVDCGSAIGQWTQYAQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query248 2.2.26 [Sep-21-2011]
O08574 370 Mesoderm posterior protei yes N/A 0.225 0.151 0.526 4e-09
Q0VG99 397 Mesoderm posterior protei yes N/A 0.294 0.183 0.432 1e-08
P97309243 Mesoderm posterior protei no N/A 0.225 0.230 0.508 3e-08
Q9BRJ9268 Mesoderm posterior protei no N/A 0.225 0.208 0.508 6e-08
P22980324 Myoblast determination pr no N/A 0.411 0.314 0.351 9e-08
P70661214 Neurogenin-3 OS=Mus muscu no N/A 0.318 0.369 0.418 1e-07
O09105 330 Neurogenic differentiatio no N/A 0.262 0.196 0.484 3e-06
Q9HD90 331 Neurogenic differentiatio no N/A 0.245 0.184 0.5 3e-06
Q6VNZ9239 Myogenic factor 6 OS=Dani no N/A 0.258 0.267 0.441 4e-06
O88940201 Musculin OS=Mus musculus no N/A 0.512 0.631 0.267 4e-06
>sp|O08574|MESP2_MOUSE Mesoderm posterior protein 2 OS=Mus musculus GN=Mesp2 PE=1 SV=1 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 40/57 (70%), Gaps = 1/57 (1%)

Query: 144 KKTACDRERTRMRDMNRAFDLLRNRLPP-CKPPGKKLSKIESLRMAIRYIRHLQCLL 199
           +++A +RE+ RMR + RA   LR  LPP   P G+ L+KIE+LR+AIRYI HL  LL
Sbjct: 81  RQSASEREKLRMRTLARALQELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSALL 137




Transcription factor with important role in somitogenesis. Defines the rostrocaudal patterning of the somite by participating in distinct Notch pathways. Regulates also the FGF signaling pathway. Specifies the rostral half of the somites. Generates rostro-caudal polarity of somites by down-regulating in the presumptive rostral domain DLL1, a Notch ligand. Participates in the segment border formation by activating in the anterior presomitic mesoderm LFNG, a negative regulator of DLL1-Notch signaling. Acts as a strong suppressor of Notch activity. Together with MESP1 is involved in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. May play a role with Tcf15 in the differentiation of myotomal and sclerotomal cells by regulating Pax family genes. Controls also the expression of the protocadherin PCDH8/PAPC, EPHA4, RIPPLY2, NOTCH2, FGFR1, and CER1. Binds to the E-boxes within the EPH4A and RIPPLY2 enhancers.
Mus musculus (taxid: 10090)
>sp|Q0VG99|MESP2_HUMAN Mesoderm posterior protein 2 OS=Homo sapiens GN=MESP2 PE=1 SV=2 Back     alignment and function description
>sp|P97309|MESP1_MOUSE Mesoderm posterior protein 1 OS=Mus musculus GN=Mesp1 PE=2 SV=2 Back     alignment and function description
>sp|Q9BRJ9|MESP1_HUMAN Mesoderm posterior protein 1 OS=Homo sapiens GN=MESP1 PE=2 SV=1 Back     alignment and function description
>sp|P22980|MYOD1_CAEEL Myoblast determination protein 1 homolog OS=Caenorhabditis elegans GN=hlh-1 PE=2 SV=2 Back     alignment and function description
>sp|P70661|NGN3_MOUSE Neurogenin-3 OS=Mus musculus GN=Neurog3 PE=2 SV=1 Back     alignment and function description
>sp|O09105|NDF4_MOUSE Neurogenic differentiation factor 4 OS=Mus musculus GN=Neurod4 PE=1 SV=1 Back     alignment and function description
>sp|Q9HD90|NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens GN=NEUROD4 PE=2 SV=2 Back     alignment and function description
>sp|Q6VNZ9|MYF6_DANRE Myogenic factor 6 OS=Danio rerio GN=myf6 PE=2 SV=1 Back     alignment and function description
>sp|O88940|MUSC_MOUSE Musculin OS=Mus musculus GN=Msc PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
328696800240 PREDICTED: myogenic factor 6-like [Acyrt 0.318 0.329 0.831 1e-31
340717970276 PREDICTED: hypothetical protein LOC10064 0.383 0.344 0.64 1e-24
321474125 565 hypothetical protein DAPPUDRAFT_222754 [ 0.306 0.134 0.7 3e-23
242017291251 conserved hypothetical protein [Pediculu 0.407 0.402 0.537 9e-23
195062140298 GH13982 [Drosophila grimshawi] gi|193891 0.649 0.540 0.430 1e-21
383855130248 PREDICTED: uncharacterized protein LOC10 0.258 0.258 0.787 2e-21
195453304316 GK12985 [Drosophila willistoni] gi|19416 0.241 0.189 0.766 1e-20
195394549308 GJ10515 [Drosophila virilis] gi|19414261 0.306 0.246 0.641 3e-20
347969660 436 AGAP013335-PA [Anopheles gambiae str. PE 0.274 0.155 0.705 3e-20
195330472266 GM26275 [Drosophila sechellia] gi|194120 0.241 0.225 0.766 3e-20
>gi|328696800|ref|XP_001948879.2| PREDICTED: myogenic factor 6-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  142 bits (359), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 74/83 (89%), Gaps = 4/83 (4%)

Query: 138 DSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQC 197
           +SERDYKK+ACDRERTRMRDMN+AFDLLRNRLP  KPPGKKLSKIESLRMAIRYIRHLQ 
Sbjct: 128 ESERDYKKSACDRERTRMRDMNKAFDLLRNRLPKSKPPGKKLSKIESLRMAIRYIRHLQA 187

Query: 198 LLEYGPEYETILYSSRSVVPSST 220
           +LEYGPEYET LY+    VPS T
Sbjct: 188 ILEYGPEYETKLYT----VPSCT 206




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340717970|ref|XP_003397446.1| PREDICTED: hypothetical protein LOC100643488 [Bombus terrestris] Back     alignment and taxonomy information
>gi|321474125|gb|EFX85091.1| hypothetical protein DAPPUDRAFT_222754 [Daphnia pulex] Back     alignment and taxonomy information
>gi|242017291|ref|XP_002429125.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212513989|gb|EEB16387.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195062140|ref|XP_001996141.1| GH13982 [Drosophila grimshawi] gi|193891933|gb|EDV90799.1| GH13982 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|383855130|ref|XP_003703071.1| PREDICTED: uncharacterized protein LOC100875375 [Megachile rotundata] Back     alignment and taxonomy information
>gi|195453304|ref|XP_002073729.1| GK12985 [Drosophila willistoni] gi|194169814|gb|EDW84715.1| GK12985 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195394549|ref|XP_002055905.1| GJ10515 [Drosophila virilis] gi|194142614|gb|EDW59017.1| GJ10515 [Drosophila virilis] Back     alignment and taxonomy information
>gi|347969660|ref|XP_003436440.1| AGAP013335-PA [Anopheles gambiae str. PEST] gi|333469672|gb|EGK97373.1| AGAP013335-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195330472|ref|XP_002031927.1| GM26275 [Drosophila sechellia] gi|194120870|gb|EDW42913.1| GM26275 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
FB|FBgn0037672268 sage "salivary gland-expressed 0.262 0.242 0.723 1e-20
UNIPROTKB|F1P3S4 323 LOC100858087 "Uncharacterized 0.419 0.321 0.379 1.6e-10
ZFIN|ZDB-GENE-000616-6254 myf5 "myogenic factor 5" [Dani 0.423 0.413 0.384 1.5e-08
UNIPROTKB|J9NRP1173 ASCL4 "Uncharacterized protein 0.294 0.421 0.418 2e-08
WB|WBGene00001958246 hlh-14 [Caenorhabditis elegans 0.326 0.329 0.378 2.7e-08
FB|FBgn0053557150 CG33557 [Drosophila melanogast 0.262 0.433 0.449 4.4e-08
UNIPROTKB|F1NMI5147 ASCL4 "Uncharacterized protein 0.217 0.367 0.490 7.8e-08
UNIPROTKB|F1SK05256 MESP1 "Uncharacterized protein 0.245 0.238 0.483 8.9e-08
ZFIN|ZDB-GENE-090817-2256 mespab "mesoderm posterior ab" 0.254 0.246 0.469 8.9e-08
RGD|1305959 368 Mesp2 "mesoderm posterior 2 ho 0.225 0.152 0.526 1.2e-07
FB|FBgn0037672 sage "salivary gland-expressed bHLH" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 244 (91.0 bits), Expect = 1.0e-20, P = 1.0e-20
 Identities = 47/65 (72%), Positives = 54/65 (83%)

Query:   135 KISDSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRH 194
             K    E+DY++TACDRERTRMRDMNRAFDLLR++LP  KP GKK SKIESLR+AI YI H
Sbjct:   172 KALQMEKDYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINH 231

Query:   195 LQCLL 199
             LQ +L
Sbjct:   232 LQAML 236




GO:0005634 "nucleus" evidence=IC
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
UNIPROTKB|F1P3S4 LOC100858087 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000616-6 myf5 "myogenic factor 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRP1 ASCL4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00001958 hlh-14 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0053557 CG33557 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMI5 ASCL4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SK05 MESP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090817-2 mespab "mesoderm posterior ab" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1305959 Mesp2 "mesoderm posterior 2 homolog (mouse)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 6e-18
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 5e-17
smart0035353 smart00353, HLH, helix loop helix domain 2e-16
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information
 Score = 74.4 bits (184), Expect = 6e-18
 Identities = 29/54 (53%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 143 YKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQ 196
            +K   +RER R   +N AF+ LR  LP   PP KKLSK E LR+AI YI+HLQ
Sbjct: 1   RRKAHNERERRRRDRINDAFEELRELLPT--PPNKKLSKAEILRLAIEYIKHLQ 52


Length = 52

>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
KOG3960|consensus284 99.73
KOG4029|consensus228 99.68
KOG3898|consensus254 99.58
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.45
KOG4395|consensus285 99.38
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.35
smart0035353 HLH helix loop helix domain. 99.26
KOG0561|consensus 373 99.13
KOG4447|consensus173 99.11
KOG3910|consensus632 98.9
KOG1319|consensus229 98.29
KOG1318|consensus411 98.23
KOG2483|consensus232 97.62
KOG2588|consensus 953 97.11
KOG4304|consensus 250 97.06
KOG3561|consensus 803 96.55
KOG4447|consensus173 96.39
PF01056329 Myc_N: Myc amino-terminal region; InterPro: IPR012 93.35
PLN0321793 transcription factor ATBS1; Provisional 93.07
KOG3558|consensus 768 87.88
>KOG3960|consensus Back     alignment and domain information
Probab=99.73  E-value=1e-17  Score=151.78  Aligned_cols=77  Identities=42%  Similarity=0.640  Sum_probs=67.2

Q ss_pred             cccccCCCCccchHHhhHhhHHHHHHHHHHHHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHhcCCCcccc
Q psy9185         129 TTRCHRKISDSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYGPEYETI  208 (248)
Q Consensus       129 ~~r~~r~~~~~~~~rR~~aN~RER~Rm~~lN~AF~~LR~~LP~~~~~~kKLSKietLr~Ai~YI~~L~~lL~~~~~~~~~  208 (248)
                      ++-|||+...  .+||++|.+|||+|++.||+||+.|+++  ++..++++|.||||||.||+||..|+.||++....+..
T Consensus       106 ckackrks~s--vDRRKAATMRERRRLkKVNEAFE~LKRr--T~~NPNQRLPKVEILRsAI~YIE~Lq~LL~~~~~~~~~  181 (284)
T KOG3960|consen  106 CKACKRKSTS--VDRRKAATMRERRRLKKVNEAFETLKRR--TSSNPNQRLPKVEILRSAIRYIERLQALLQEQDQAEKG  181 (284)
T ss_pred             hhhccccccc--hhHHHHHHHHHHHHHHHHHHHHHHHHhh--cCCCccccccHHHHHHHHHHHHHHHHHHHHHhhccchh
Confidence            6788887654  5799999999999999999999999999  44578999999999999999999999999998655543


Q ss_pred             c
Q psy9185         209 L  209 (248)
Q Consensus       209 ~  209 (248)
                      +
T Consensus       182 ~  182 (284)
T KOG3960|consen  182 L  182 (284)
T ss_pred             h
Confidence            3



>KOG4029|consensus Back     alignment and domain information
>KOG3898|consensus Back     alignment and domain information
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>KOG4395|consensus Back     alignment and domain information
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG0561|consensus Back     alignment and domain information
>KOG4447|consensus Back     alignment and domain information
>KOG3910|consensus Back     alignment and domain information
>KOG1319|consensus Back     alignment and domain information
>KOG1318|consensus Back     alignment and domain information
>KOG2483|consensus Back     alignment and domain information
>KOG2588|consensus Back     alignment and domain information
>KOG4304|consensus Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>KOG4447|consensus Back     alignment and domain information
>PF01056 Myc_N: Myc amino-terminal region; InterPro: IPR012682 The class III basic helix-turn-helix (bHLH) transcription factors have proliferative and apoptotic roles and are characterised by the presence of a leucine zipper adjacent to the bHLH domain Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>KOG3558|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
1mdy_B62 Crystal Structure Of Myod Bhlh Domain Bound To Dna: 2e-05
2ql2_B60 Crystal Structure Of The Basic-Helix-Loop-Helix Dom 2e-05
1mdy_A68 Crystal Structure Of Myod Bhlh Domain Bound To Dna: 3e-05
>pdb|1MDY|B Chain B, Crystal Structure Of Myod Bhlh Domain Bound To Dna: Perspectives On Dna Recognition And Implications For Transcriptional Activation Length = 62 Back     alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Query: 142 DYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLL 199 D +K A RER R+ +N AF+ L+ P ++L K+E LR AIRYI LQ LL Sbjct: 5 DRRKAATMRERRRLSKVNEAFETLKR--STSSNPNQRLPKVEILRNAIRYIEGLQALL 60
>pdb|2QL2|B Chain B, Crystal Structure Of The Basic-Helix-Loop-Helix Domains Of The Heterodimer E47NEUROD1 BOUND TO DNA Length = 60 Back     alignment and structure
>pdb|1MDY|A Chain A, Crystal Structure Of Myod Bhlh Domain Bound To Dna: Perspectives On Dna Recognition And Implications For Transcriptional Activation Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 8e-24
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 1e-22
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1hlo_A80 Protein (transcription factor MAX); transcriptiona 8e-08
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 2e-07
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 3e-07
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 8e-07
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 2e-06
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 3e-05
1a0a_A63 BHLH, protein (phosphate system positive regulator 4e-05
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 5e-05
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 1e-04
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Length = 60 Back     alignment and structure
 Score = 89.6 bits (223), Expect = 8e-24
 Identities = 27/59 (45%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 144 KKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYG 202
           +  A  RER RM  +N A D LR  +P C    +KLSKIE+LR+A  YI  L  +L  G
Sbjct: 3   RMKANARERNRMHGLNAALDNLRKVVP-CYSKTQKLSKIETLRLAKNYIWALSEILRSG 60


>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Length = 68 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Length = 76 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.88
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.87
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 99.8
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 99.79
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.67
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.55
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.49
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.48
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.41
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.3
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.23
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.15
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.14
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.13
4ati_A118 MITF, microphthalmia-associated transcription fact 99.12
4f3l_A 361 Mclock, circadian locomoter output cycles protein 98.42
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.24
4ath_A83 MITF, microphthalmia-associated transcription fact 97.85
3muj_A138 Transcription factor COE3; immunoglobulin like fol 93.04
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
Probab=99.88  E-value=5.1e-23  Score=148.89  Aligned_cols=59  Identities=44%  Similarity=0.585  Sum_probs=55.2

Q ss_pred             HhhHhhHHHHHHHHHHHHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHhcC
Q psy9185         143 YKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEYG  202 (248)
Q Consensus       143 rR~~aN~RER~Rm~~lN~AF~~LR~~LP~~~~~~kKLSKietLr~Ai~YI~~L~~lL~~~  202 (248)
                      +|.+||+|||+||+.||+||+.||.+||. .+.++||||++||++|++||.+|+++|+++
T Consensus         2 rR~~~N~rER~R~~~iN~af~~LR~~lP~-~~~~~klSKi~tLr~Ai~YI~~L~~~L~~g   60 (60)
T 2ql2_B            2 RRMKANARERNRMHGLNAALDNLRKVVPC-YSKTQKLSKIETLRLAKNYIWALSEILRSG   60 (60)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTSSS-CCSSSCCCHHHHHHHHHHHHHHHHHHTTC-
T ss_pred             ccchhhHHHHHHHHHHHHHHHHHHHHccC-CCCcCcCCHHHHHHHHHHHHHHHHHHHhcC
Confidence            78899999999999999999999999995 678999999999999999999999999864



>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 248
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 1e-15
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 4e-14
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 4e-12
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 2e-11
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 1e-10
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 2e-10
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 1e-08
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 2e-04
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myod B/HLH domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 67.2 bits (164), Expect = 1e-15
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 134 RKISDSERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIR 193
           RK ++++R  +K A  RER R+  +N AF+ L+        P ++L K+E LR AIRYI 
Sbjct: 5   RKTTNADR--RKAATMRERRRLSKVNEAFETLKRSTSSN--PNQRLPKVEILRNAIRYIE 60

Query: 194 HLQCLLE 200
            LQ LL 
Sbjct: 61  GLQALLR 67


>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.65
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.44
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.42
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.35
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 98.6
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myod B/HLH domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.65  E-value=1.2e-16  Score=115.67  Aligned_cols=61  Identities=43%  Similarity=0.644  Sum_probs=54.9

Q ss_pred             cchHHhhHhhHHHHHHHHHHHHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHhc
Q psy9185         139 SERDYKKTACDRERTRMRDMNRAFDLLRNRLPPCKPPGKKLSKIESLRMAIRYIRHLQCLLEY  201 (248)
Q Consensus       139 ~~~~rR~~aN~RER~Rm~~lN~AF~~LR~~LP~~~~~~kKLSKietLr~Ai~YI~~L~~lL~~  201 (248)
                      ....+|..+|.+||.|+..||++|+.|+.+||.+  +.+|++|++||+.||+||.+|+++|++
T Consensus         8 ~~~~rR~~hn~~Er~Rr~~in~~~~~L~~llP~~--~~~k~sK~~iL~~Ai~YI~~Lq~~l~e   68 (68)
T d1mdya_           8 TNADRRKAATMRERRRLSKVNEAFETLKRSTSSN--PNQRLPKVEILRNAIRYIEGLQALLRD   68 (68)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCSC--TTSCCCHHHHHHHHHHHHHHHHHTTCC
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--CCCCCCHHHHHHHHHHHHHHHHHHhhC
Confidence            3456889999999999999999999999999963  467999999999999999999998864



>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure