Diaphorina citri psyllid: psy9188


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MLFLFLQKHAREHGLPWTVGKSFDTACPVSDFIPEHEIKDPDDVPLWLKVNGELRQKSTTGDMLFKTGDLISYISQHMTLEPYDLILTGKAGFILMFQQSPHSV
ccHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEccEEEECcccccccccHHHHHHHHHHHcccccccEEEccccccccccccccccc
MLFLFLQKHAREHGLPWTVGKSFDTACPVSDFIPEHEIKDPDDVPLWLKVNGELRQKSTTGDMLFKTGDLISYISQHMTLEPYDLILTGKAGFILMFQQS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFLFLQKHAREHGLPWTVGKSFDTACPVSDFIPEHEIKDPDDVPLWLKVNGELRQKSTTGDMLFKTGDLISYISQHMTLEPYDLILTGKAGFILMFQQSPHSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acylpyruvase FAHD1, mitochondrial Probable mitochondrial acylpyruvase which is able to hydrolyze acetylpyruvate and fumarylpyruvate in vitro.confidentQ86I22
Acylpyruvase FAHD1, mitochondrial Probable mitochondrial acylpyruvase which is able to hydrolyze acetylpyruvate and fumarylpyruvate in vitro.confidentQ6AYQ8
Acylpyruvase FAHD1, mitochondrial Probable mitochondrial acylpyruvase which is able to hydrolyze acetylpyruvate and fumarylpyruvate in vitro.confidentQ5RDW0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034545 [MF]fumarylpyruvate hydrolase activityprobableGO:0016823, GO:0016822, GO:0003824, GO:0003674, GO:0016787
GO:0005507 [MF]copper ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0018773 [MF]acetylpyruvate hydrolase activityprobableGO:0016823, GO:0016822, GO:0003824, GO:0003674, GO:0016787

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SAW, chain A
Confidence level:very confident
Coverage over the Query: 1-103
View the alignment between query and template
View the model in PyMOL