Diaphorina citri psyllid: psy918

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----

MGVIEKFMPLPHDEKKRRECLTLSLQTSDCTFATSNIKPLSVVSLPRRMPTLRLVSHEPGRNNIHTGRTQAEIQPRIPMAVTNAVSWPNNNNSILFIMSASALYILDVKGKVLISRNYRGDVEMGVIEKFMPLLMEKEEEGMLTPLLQTSDCTFAYIKYNNLFIVSTTKKNANIALVFVFLNKIVRVFTEYFKEIEEESIRDNFVVIYELLDELIDFGYPQTTDSKILQEYITQEGHKLEIQPRIPMAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANSNGNVLRSEIVGAIKMRVYLSGMPELRLGLNDKVLFESTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERFVHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSVKYTPEQSAITWTIKSFPGGKEYLMRAHFGLPSVENEDAEGKPPIQVKFEIPYFTTSGIQVRYLKIIEKSGYQALPW

cccccccccccccHHccccEEEEEECcccCEEEcccccccEEECccccccccEEEcccccccccccccccccccccccEEEEccCECccccccEEEEEEEEEEEEEcccccEEEECcccccccccHHHHHHHHHHHcccccccccEEEEccEEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHcccccccccHHHHccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEccccCEEEECcccccccccccccccEEEEccccccccccccccccccEEEEEcccccEEEEEEECcccccccEEEEEEEEEEccEEEEEEEEEEEcccccccccEEEEEEcccccccccEEEECccEEEECccccEEEEEEccccccccEEEEEEECccccccccccccccEEEEEEEccccccccEEEEEEEEEccccccccc

**VIEKFMPLPHDEKKRRECLTLSLQTSDCTFATSNIKPLSVVSLPRR************************IQPRIPMAVTNAVSWPNNNNSILFIMSASALYILDVKGKVLISRNYRGDVEMGVIEKFMPLLMEKEEEGMLTPLLQTSDCTFAYIKYNNLFIVSTTKKNANIALVFVFLNKIVRVFTEYFKEIEEESIRDNFVVIYELLDELIDFGYPQTTDSKILQEYITQEGH***IQPRIPMAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANSNGNVLRSEIVGAIKMRVYLSGMPELRLGLNDKVLFEST******SVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERFVHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSVKYTPEQSAITWTIKSFPGGKEYLMRAHFGLPS**********PIQVKFEIPYFTTSGIQVRYLKIIEKSGY***PW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
AP-1 complex subunit mu-1	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.	very confident	P35585
AP-1 complex subunit mu-1	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.	very confident	Q9BXS5
AP-1 complex subunit mu-1	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.	very confident	Q2KJ81

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006892 [BP]	post-Golgi vesicle-mediated transport	confident	GO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:2001136 [BP]	negative regulation of endocytic recycling	confident	GO:0032879, GO:0060341, GO:0051051, GO:0051049, GO:0032386, GO:0032387, GO:0050794, GO:0008150, GO:0065007, GO:2001135, GO:0048519, GO:0060627, GO:0050789, GO:0048523
GO:0030121 [CC]	AP-1 adaptor complex	confident	GO:0044464, GO:0030135, GO:0043229, GO:0030117, GO:0012510, GO:0030131, GO:0030130, GO:0030119, GO:0030118, GO:0043227, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0031982, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0030125, GO:0048475, GO:0005794, GO:0030140, GO:0005798, GO:0030133, GO:0030658, GO:0030659, GO:0012505, GO:0012506, GO:0030120, GO:0030660, GO:0043234, GO:0032991, GO:0043231, GO:0030665, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0031090, GO:0044424, GO:0044425, GO:0044422, GO:0000139
GO:0035646 [BP]	endosome to melanosome transport	confident	GO:0030154, GO:0048757, GO:0048066, GO:0010259, GO:0044699, GO:0051716, GO:0048869, GO:0043485, GO:0043482, GO:0033059, GO:0051641, GO:0032502, GO:0009987, GO:0050931, GO:0006810, GO:0044767, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0016482, GO:0016197, GO:0043473, GO:0043476, GO:0009605, GO:0046907, GO:0050896, GO:0008150
GO:0006903 [BP]	vesicle targeting	confident	GO:0009987, GO:0016192, GO:0051234, GO:0006810, GO:0051179, GO:0044763, GO:0051640, GO:0051648, GO:0051649, GO:0008150, GO:0051656, GO:0051650, GO:0044699, GO:0051641
GO:0008565 [MF]	protein transporter activity	confident	GO:0005215, GO:0022892, GO:0003674
GO:0019886 [BP]	antigen processing and presentation of exogenous peptide antigen via MHC class II	confident	GO:0002504, GO:0019882, GO:0019884, GO:0002478, GO:0002495, GO:0002376, GO:0008150, GO:0048002
GO:0009306 [BP]	protein secretion	confident	GO:0033036, GO:0046903, GO:0006810, GO:0071702, GO:0044765, GO:0045184, GO:0032940, GO:0008104, GO:0044763, GO:0051649, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0008021 [CC]	synaptic vesicle	confident	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0045746 [BP]	negative regulation of Notch signaling pathway	confident	GO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0032438 [BP]	melanosome organization	confident	GO:0006996, GO:0043473, GO:0048753, GO:0071840, GO:0009987, GO:0016050, GO:0033059, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0002119 [BP]	nematode larval development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0016183 [BP]	synaptic vesicle coating	confident	GO:0019226, GO:0035637, GO:0051649, GO:0006901, GO:0006900, GO:0061024, GO:0032501, GO:0023052, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0016185, GO:0016044, GO:0071840, GO:0016043, GO:0048488, GO:0097479, GO:0051641, GO:0006810, GO:0050877, GO:0009987, GO:0070142, GO:0044765, GO:0044763, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0003008, GO:0006996, GO:0044700, GO:0006897, GO:0016192, GO:0044707, GO:0016050, GO:0051640, GO:0008150
GO:0009887 [BP]	organ morphogenesis	confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0040011 [BP]	locomotion	confident	GO:0008150
GO:0040010 [BP]	positive regulation of growth rate	confident	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0032588 [CC]	trans-Golgi network membrane	confident	GO:0005802, GO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0033363 [BP]	secretory granule organization	confident	GO:0006996, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0016050, GO:0008150, GO:0044699
GO:0005765 [CC]	lysosomal membrane	confident	GO:0005737, GO:0044446, GO:0000323, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0005764, GO:0044444, GO:0044437, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0050690 [BP]	regulation of defense response to virus by virus	confident	GO:0050688, GO:0048583, GO:0080134, GO:0002831, GO:0043900, GO:0008150, GO:0002697, GO:0002682, GO:0065007, GO:0050789, GO:0031347
GO:0006605 [BP]	protein targeting	confident	GO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0051641
GO:0006950 [BP]	response to stress	confident	GO:0050896, GO:0008150
GO:0048749 [BP]	compound eye development	confident	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0042384 [BP]	cilium assembly	confident	GO:0022607, GO:0030030, GO:0030031, GO:0010927, GO:0009653, GO:0044699, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0060271, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0032990, GO:0006996, GO:0048858, GO:0048856, GO:0044085, GO:0008150, GO:0044782
GO:0009792 [BP]	embryo development ending in birth or egg hatching	confident	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]	growth	confident	GO:0008150
GO:0016032 [BP]	viral reproduction	confident	GO:0009987, GO:0044764, GO:0008150, GO:0051704
GO:0036170 [BP]	filamentous growth of a population of unicellular organisms in response to starvation	probable	GO:0009991, GO:0040007, GO:0009605, GO:0030447, GO:0044182, GO:0031667, GO:0006950, GO:0008150, GO:0042594, GO:0050896, GO:0044699
GO:0009267 [BP]	cellular response to starvation	probable	GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0032889 [BP]	regulation of vacuole fusion, non-autophagic	probable	GO:0033043, GO:0051128, GO:0065007, GO:0008150, GO:0050794, GO:0050789, GO:0044088
GO:0006971 [BP]	hypotonic response	probable	GO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0019048 [BP]	virus-host interaction	probable	GO:0044419, GO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0036180 [BP]	filamentous growth of a population of unicellular organisms in response to biotic stimulus	probable	GO:0009607, GO:0040007, GO:0050896, GO:0044182, GO:0008150, GO:0030447, GO:0044699
GO:0007041 [BP]	lysosomal transport	probable	GO:0009987, GO:0007034, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0007032 [BP]	endosome organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0007269 [BP]	neurotransmitter secretion	probable	GO:0019226, GO:0035637, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0044699, GO:0065007, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0044707, GO:0008150, GO:0006836
GO:0040025 [BP]	vulval development	probable	GO:0032502, GO:0009791, GO:0048856, GO:0044707, GO:0048569, GO:0032501, GO:0002119, GO:0044767, GO:0048513, GO:0002164, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0032153 [CC]	cell division site	probable	GO:0005575, GO:0044464, GO:0005623
GO:0071216 [BP]	cellular response to biotic stimulus	probable	GO:0051716, GO:0009607, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0051286 [CC]	cell tip	probable	GO:0005575, GO:0044464, GO:0005623, GO:0060187
GO:0044732 [CC]	mitotic spindle pole body	probable	GO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622
GO:0071775 []	regulation of cell cycle cytokinesis	probable
GO:0060237 [BP]	regulation of fungal-type cell wall organization	probable	GO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051128
GO:0044351 [BP]	macropinocytosis	probable	GO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0006486 [BP]	protein glycosylation	probable	GO:0044249, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0009059, GO:0044238, GO:0005975, GO:1901137, GO:1901135, GO:0043412, GO:0044237, GO:0043170, GO:0019538, GO:0043413
GO:0006896 [BP]	Golgi to vacuole transport	probable	GO:0006892, GO:0051234, GO:0007034, GO:0046907, GO:0048193, GO:0006810, GO:0051179, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0016192, GO:0044699, GO:0016482
GO:0030669 [CC]	clathrin-coated endocytic vesicle membrane	probable	GO:0030139, GO:0043229, GO:0030135, GO:0043226, GO:0030136, GO:0030665, GO:0005575, GO:0030666, GO:0031090, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0005737, GO:0030659, GO:0045334, GO:0012505, GO:0012506, GO:0031982, GO:0043227, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0035976 [CC]	AP1 complex	probable	GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0030276 [MF]	clathrin binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030123 [CC]	AP-3 adaptor complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0030117, GO:0044424, GO:0044425, GO:0030119, GO:0048475
GO:0031201 [CC]	SNARE complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425
GO:0005905 [CC]	coated pit	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W63, chain M
Confidence level:very confident
Coverage over the Query: 99-242,253-313,327-458,469-504
View the alignment between query and template
View the model in PyMOL

Template: 1W63, chain M
Confidence level:very confident
Coverage over the Query: 2-74,85-123
View the alignment between query and template
View the model in PyMOL