Diaphorina citri psyllid: psy9193


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MVHMVGSYPPSLELQSYTTPPEDAPSGMLARGVYSVQSLFTDDDDAEHLKWVTLILLPLRFAVDKMVHMVGSYPPSLELQSYTTPPEDAPSGMLARGVYSVQSLFTDDDDAEHLKWEWTFEIKKSWKD
cEEEEEEcccccccccccccccccccCEEcccEEEEEEEEECccccccccEEEEEEEEcEEEEEEEEEEEEcccccccccEEcccccccccCEEEEEEEEEEEEEEccccccEEEEEEEEEEEccccc
MVHMVGSYPPSLELQSYTTPPEDAPSGMLARGVYSVQSLFTDDDDAEHLKWVTLILLPLRFAVDKMVHMVGSYPPSLELQSYTTPPEDAPSGMLARGVYSVQSLFTDDDDAEHLKWEWTFEIKKSW**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVHMVGSYPPSLELQSYTTPPEDAPSGMLARGVYSVQSLFTDDDDAEHLKWVTLILLPLRFAVDKMVHMVGSYPPSLELQSYTTPPEDAPSGMLARGVYSVQSLFTDDDDAEHLKWEWTFEIKKSWKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative rho GDP-dissociation inhibitor 1 Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them (By similarity). Regulates the Rac-dependent signaling pathways controlling cytokinesis, actin reorganization and the contractile vacuole. Required for efficient accumulation of cap at the cell cortex.confidentQ95UQ1
Rho GDP-dissociation inhibitor 1 Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.confidentP52565
Rho GDP-dissociation inhibitor 1 Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.confidentQ5XI73

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007162 [BP]negative regulation of cell adhesionprobableGO:0030155, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0051056 [BP]regulation of small GTPase mediated signal transductionprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0005094 [MF]Rho GDP-dissociation inhibitor activityprobableGO:0005092, GO:0005083, GO:0030695, GO:0003674, GO:0060589, GO:0030234
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0001772 [CC]immunological synapseprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0032880 [BP]regulation of protein localizationprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0032502 [BP]developmental processprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007266 [BP]Rho protein signal transductionprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007265, GO:0007264, GO:0035556, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DS6, chain B
Confidence level:very confident
Coverage over the Query: 32-127
View the alignment between query and template
View the model in PyMOL
Template: 1KMT, chain A
Confidence level:very confident
Coverage over the Query: 2-55
View the alignment between query and template
View the model in PyMOL