Diaphorina citri psyllid: psy9195

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MAEHDDVRAGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTLRV
ccccHHHHHHHHcHHHHHHHHHHHHcccccEEEEEEEccccccEEcccccccccccccccccccHHEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEEEcccccEEccccccccEEccccc
***HDDVRAGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEHDDVRAGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTLRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Voltage-dependent calcium channel subunit alpha-2/delta-3 The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) but not T-type (CACNA1G).confidentQ8IZS8
Voltage-dependent calcium channel subunit alpha-2/delta-3 The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) but not T-type (CACNA1G).confidentQ9Z1L5
Voltage-dependent calcium channel subunit alpha-2/delta-3 The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) but not T-type (CACNA1G).confidentQ8CFG5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005891 [CC]voltage-gated calcium channel complexprobableGO:0043234, GO:0032991, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034704, GO:0071944, GO:0034702, GO:0034703, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0005245 [MF]voltage-gated calcium channel activityprobableGO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0072509, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0022839, GO:0022838
GO:0006816 [BP]calcium ion transportprobableGO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FX5, chain A
Confidence level:confident
Coverage over the Query: 73-137
View the alignment between query and template
View the model in PyMOL
Template: 3BY9, chain A
Confidence level:probable
Coverage over the Query: 2-83
View the alignment between query and template
View the model in PyMOL