Psyllid ID: psy9195

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MAEHDDVRAGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTLRV
ccccHHHHHHHHcHHHHHHHHHHHHcccccEEEEEEEccccccEEcccccccccccccccccccHHEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEEEcccccEEccccccccEEccccc
ccccHHHHHHccHHHHHHHHHHHHHcccccEEEEEEccccccEEEccccccccccccEEccccccEEEEEccccccEEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEccccccEEEEEccc
maehddvrAGLMWSEGLDEVFrenymadptLLWQYFGsakgflrtypdkedapaedliFDCRNRQWYIQATTCSKDVVILVDnsgsmagmrNTTAKLVLHSLLQTFSNNDFINIFKfnltvdtivpclgnyslvqtlrv
maehddvraglmWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGnyslvqtlrv
MAEHDDVRAGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTLRV
********AGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQT***
**EHDDVRAGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTL**
********AGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTLRV
***HDDVRAGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTLR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEHDDVRAGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLIFDCRNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTLRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
Q8IZS8 1091 Voltage-dependent calcium yes N/A 0.920 0.117 0.541 3e-34
Q9Z1L5 1091 Voltage-dependent calcium yes N/A 0.920 0.117 0.541 3e-34
Q8CFG5 1085 Voltage-dependent calcium yes N/A 0.920 0.117 0.541 3e-34
Q7Z3S7 1137 Voltage-dependent calcium no N/A 0.949 0.116 0.533 1e-32
Q5RJF7 1116 Voltage-dependent calcium no N/A 0.949 0.118 0.511 2e-31
O08532 1103 Voltage-dependent calcium no N/A 0.776 0.097 0.442 5e-22
P54289 1103 Voltage-dependent calcium no N/A 0.776 0.097 0.433 5e-22
Q9NY47 1150 Voltage-dependent calcium no N/A 0.776 0.093 0.458 1e-21
P13806 1106 Voltage-dependent calcium no N/A 0.776 0.097 0.424 2e-21
Q8CFG6 1157 Voltage-dependent calcium no N/A 0.776 0.093 0.458 2e-21
>sp|Q8IZS8|CA2D3_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Homo sapiens GN=CACNA2D3 PE=1 SV=1 Back     alignment and function desciption
 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 3/131 (2%)

Query: 10  GLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAED--LIFDCRNRQWY 67
           G+ WSE L++VF +N+  DP+L+WQYFGSAKGF R YP  +  P E+  + FDCRNR+WY
Sbjct: 188 GVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWY 247

Query: 68  IQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPC 127
           IQA T  KDVVILVD SGSM G+R T AK  + S+L T  ++DF NI  +N  +  + PC
Sbjct: 248 IQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPC 307

Query: 128 LGNYSLVQTLR 138
           L N +LVQ  R
Sbjct: 308 L-NGTLVQADR 317
The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) but not T-type (CACNA1G).
Homo sapiens (taxid: 9606)
>sp|Q9Z1L5|CA2D3_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Mus musculus GN=Cacna2d3 PE=1 SV=1 Back     alignment and function description
>sp|Q8CFG5|CA2D3_RAT Voltage-dependent calcium channel subunit alpha-2/delta-3 OS=Rattus norvegicus GN=Cacna2d3 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z3S7|CA2D4_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Homo sapiens GN=CACNA2D4 PE=1 SV=2 Back     alignment and function description
>sp|Q5RJF7|CA2D4_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-4 OS=Mus musculus GN=Cacna2d4 PE=2 SV=1 Back     alignment and function description
>sp|O08532|CA2D1_MOUSE Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Mus musculus GN=Cacna2d1 PE=1 SV=1 Back     alignment and function description
>sp|P54289|CA2D1_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Homo sapiens GN=CACNA2D1 PE=1 SV=3 Back     alignment and function description
>sp|Q9NY47|CA2D2_HUMAN Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Homo sapiens GN=CACNA2D2 PE=1 SV=2 Back     alignment and function description
>sp|P13806|CA2D1_RABIT Voltage-dependent calcium channel subunit alpha-2/delta-1 OS=Oryctolagus cuniculus GN=CACNA2D1 PE=1 SV=1 Back     alignment and function description
>sp|Q8CFG6|CA2D2_RAT Voltage-dependent calcium channel subunit alpha-2/delta-2 OS=Rattus norvegicus GN=Cacna2d2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
242013157 1205 dihydropyridine-sensitive L-type calcium 0.892 0.102 0.566 2e-36
195436949 1209 GK18111 [Drosophila willistoni] gi|19416 0.877 0.100 0.562 1e-35
170031185 1165 dihydropyridine-sensitive l-type calcium 0.928 0.110 0.569 4e-35
198473170 1213 GA11645 [Drosophila pseudoobscura pseudo 0.892 0.102 0.561 1e-34
195164890 1221 GL21046 [Drosophila persimilis] gi|19410 0.892 0.101 0.561 1e-34
195033822 1180 GH10400 [Drosophila grimshawi] gi|193904 0.892 0.105 0.553 1e-34
118790455 1164 AGAP009579-PA [Anopheles gambiae str. PE 0.920 0.109 0.565 3e-34
157128122 1100 dihydropyridine-sensitive l-type calcium 0.892 0.112 0.564 7e-34
157109793 1173 dihydropyridine-sensitive l-type calcium 0.892 0.105 0.564 7e-34
194857753 2154 GG25194 [Drosophila erecta] gi|190660891 0.863 0.055 0.522 1e-33
>gi|242013157|ref|XP_002427281.1| dihydropyridine-sensitive L-type calcium channel subunits alpha-2/delta precursor calcium channel subunit, putative [Pediculus humanus corporis] gi|212511622|gb|EEB14543.1| dihydropyridine-sensitive L-type calcium channel subunits alpha-2/delta precursor calcium channel subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/127 (56%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 11  LMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAEDLI--FDCRNRQWYI 68
           + WSE LDE+F +NY ADP+L WQYFGSA G +R +P  + + +++ +  +DCR R W+I
Sbjct: 161 IAWSENLDEIFSKNYQADPSLGWQYFGSAYGMMRQFPAMKWSTSDNDVDLYDCRMRPWFI 220

Query: 69  QATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCL 128
           +A TC+KD+VIL+DNSGSM GMRNT AKLV++SLL+TF NNDFIN+ KF+   +T++PC 
Sbjct: 221 EAATCTKDIVILMDNSGSMTGMRNTIAKLVVNSLLKTFGNNDFINVLKFSWKPETVMPCF 280

Query: 129 GNYSLVQ 135
            + SLVQ
Sbjct: 281 KD-SLVQ 286

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195436949|ref|XP_002066408.1| GK18111 [Drosophila willistoni] gi|194162493|gb|EDW77394.1| GK18111 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|170031185|ref|XP_001843467.1| dihydropyridine-sensitive l-type calcium channel [Culex quinquefasciatus] gi|167869243|gb|EDS32626.1| dihydropyridine-sensitive l-type calcium channel [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|198473170|ref|XP_001356194.2| GA11645 [Drosophila pseudoobscura pseudoobscura] gi|198139334|gb|EAL33254.2| GA11645 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195164890|ref|XP_002023279.1| GL21046 [Drosophila persimilis] gi|194105364|gb|EDW27407.1| GL21046 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195033822|ref|XP_001988770.1| GH10400 [Drosophila grimshawi] gi|193904770|gb|EDW03637.1| GH10400 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|118790455|ref|XP_318596.3| AGAP009579-PA [Anopheles gambiae str. PEST] gi|116117953|gb|EAA14572.4| AGAP009579-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157128122|ref|XP_001661316.1| dihydropyridine-sensitive l-type calcium channel [Aedes aegypti] gi|108872689|gb|EAT36914.1| AAEL011040-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|157109793|ref|XP_001650826.1| dihydropyridine-sensitive l-type calcium channel [Aedes aegypti] gi|108878928|gb|EAT43153.1| AAEL005392-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194857753|ref|XP_001969024.1| GG25194 [Drosophila erecta] gi|190660891|gb|EDV58083.1| GG25194 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
RGD|631361 1085 Cacna2d3 "calcium channel, vol 0.920 0.117 0.541 5.3e-31
UNIPROTKB|Q8IZS8 1091 CACNA2D3 "Voltage-dependent ca 0.920 0.117 0.541 5.3e-31
MGI|MGI:1338890 1091 Cacna2d3 "calcium channel, vol 0.920 0.117 0.541 5.3e-31
FB|FBgn0261041 1218 stj "straightjacket" [Drosophi 0.913 0.104 0.481 3.6e-30
UNIPROTKB|Q7Z3S7 1137 CACNA2D4 "Voltage-dependent ca 0.949 0.116 0.533 2.3e-29
MGI|MGI:2442632 1116 Cacna2d4 "calcium channel, vol 0.949 0.118 0.511 2.6e-28
FB|FBgn0028863 1243 CG4587 [Drosophila melanogaste 0.899 0.100 0.387 6.7e-21
MGI|MGI:88295 1103 Cacna2d1 "calcium channel, vol 0.877 0.110 0.423 4.3e-20
UNIPROTKB|F1MX37 937 CACNA2D2 "Uncharacterized prot 0.776 0.115 0.458 4.3e-20
UNIPROTKB|E1BST6 1064 CACNA2D1 "Uncharacterized prot 0.877 0.114 0.415 5.2e-20
RGD|631361 Cacna2d3 "calcium channel, voltage-dependent, alpha2/delta subunit 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 353 (129.3 bits), Expect = 5.3e-31, P = 5.3e-31
 Identities = 71/131 (54%), Positives = 91/131 (69%)

Query:    10 GLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPAED--LIFDCRNRQWY 67
             G+ WSE L++VF +N+  DP+L+WQYFGSAKGF R YP  +  P E+  + FDCRNR+WY
Sbjct:   188 GVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWY 247

Query:    68 IQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPC 127
             IQA T  KDVVILVD SGSM G+R T AK  + S+L T  ++DF NI  +N  +  + PC
Sbjct:   248 IQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIITYNEELHYVEPC 307

Query:   128 LGNYSLVQTLR 138
             L N +LVQ  R
Sbjct:   308 L-NGTLVQADR 317
GO:0005245 "voltage-gated calcium channel activity" evidence=IDA
GO:0005246 "calcium channel regulator activity" evidence=TAS
GO:0005891 "voltage-gated calcium channel complex" evidence=TAS
GO:0006816 "calcium ion transport" evidence=IDA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|Q8IZS8 CACNA2D3 "Voltage-dependent calcium channel subunit alpha-2/delta-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1338890 Cacna2d3 "calcium channel, voltage-dependent, alpha2/delta subunit 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0261041 stj "straightjacket" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z3S7 CACNA2D4 "Voltage-dependent calcium channel subunit alpha-2/delta-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2442632 Cacna2d4 "calcium channel, voltage-dependent, alpha 2/delta subunit 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0028863 CG4587 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:88295 Cacna2d1 "calcium channel, voltage-dependent, alpha2/delta subunit 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX37 CACNA2D2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BST6 CACNA2D1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8IZS8CA2D3_HUMANNo assigned EC number0.54190.92080.1173yesN/A
Q9Z1L5CA2D3_MOUSENo assigned EC number0.54190.92080.1173yesN/A
Q8CFG5CA2D3_RATNo assigned EC number0.54190.92080.1179yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
cd01463 190 cd01463, vWA_VGCC_like, VWA Voltage gated Calcium 3e-28
pfam08399123 pfam08399, VWA_N, VWA N-terminal 2e-17
TIGR03788 596 TIGR03788, marine_srt_targ, marine proteobacterial 1e-05
smart00327 175 smart00327, VWA, von Willebrand factor (vWF) type 7e-05
pfam13768156 pfam13768, VWA_3, von Willebrand factor type A dom 8e-05
cd00198161 cd00198, vWFA, Von Willebrand factor type A (vWA) 1e-04
cd01461 171 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_int 3e-04
>gnl|CDD|238740 cd01463, vWA_VGCC_like, VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information 
 Score =  102 bits (255), Expect = 3e-28
 Identities = 37/68 (54%), Positives = 45/68 (66%)

Query: 62  RNRQWYIQATTCSKDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTV 121
           RNR WYIQA T  KD+VIL+D SGSM G R   AK  + S+L T S+NDF NI  F+  V
Sbjct: 1   RNRSWYIQAATSPKDIVILLDVSGSMTGQRLHLAKQTVSSILDTLSDNDFFNIITFSNEV 60

Query: 122 DTIVPCLG 129
           + +VPC  
Sbjct: 61  NPVVPCFN 68

The alpha 2 and delta subunits result from proteolytic processing of a single gene product and carries at its N-terminus the VWA and cache domains, The alpha 2 delta gene family has orthologues in D. melanogaster and C. elegans but none have been detected in aither A. thaliana or yeast. The exact biochemical function of the VWA domain is not known but the alpha 2 delta complex has been shown to regulate various functional properties of the channel complex. Length = 190
>gnl|CDD|219821 pfam08399, VWA_N, VWA N-terminal Back     alignment and domain information
>gnl|CDD|234353 TIGR03788, marine_srt_targ, marine proteobacterial sortase target protein Back     alignment and domain information
>gnl|CDD|214621 smart00327, VWA, von Willebrand factor (vWF) type A domain Back     alignment and domain information
>gnl|CDD|222367 pfam13768, VWA_3, von Willebrand factor type A domain Back     alignment and domain information
>gnl|CDD|238119 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|238738 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
KOG2353|consensus 1104 99.95
cd01463 190 vWA_VGCC_like VWA Voltage gated Calcium channel li 99.65
PF08399123 VWA_N: VWA N-terminal; InterPro: IPR013608 This do 99.41
PF13768155 VWA_3: von Willebrand factor type A domain 99.12
cd01461 171 vWA_interalpha_trypsin_inhibitor vWA_interalpha tr 98.96
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact 98.94
TIGR03788 596 marine_srt_targ marine proteobacterial sortase tar 98.87
cd01464 176 vWA_subfamily VWA subfamily: Von Willebrand factor 98.84
cd01465 170 vWA_subgroup VWA subgroup: Von Willebrand factor t 98.81
cd01470 198 vWA_complement_factors Complement factors B and C2 98.79
PRK13685 326 hypothetical protein; Provisional 98.78
cd01456 206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor 98.77
cd01472164 vWA_collagen von Willebrand factor (vWF) type A do 98.71
cd01451 178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch 98.6
cd01480 186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI 98.55
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (v 98.49
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.48
cd01453 183 vWA_transcription_factor_IIH_type Transcription fa 98.48
cd01475 224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 98.46
cd01471 186 vWA_micronemal_protein Micronemal proteins: The To 98.45
PF13519 172 VWA_2: von Willebrand factor type A domain; PDB: 3 98.44
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extrace 98.43
TIGR00868 863 hCaCC calcium-activated chloride channel protein 1 98.42
cd01454 174 vWA_norD_type norD type: Denitrifying bacteria con 98.41
TIGR03436 296 acidobact_VWFA VWFA-related Acidobacterial domain. 98.4
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor 98.38
COG4245 207 TerY Uncharacterized protein encoded in toxicity p 98.36
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand 98.34
smart00327 177 VWA von Willebrand factor (vWF) type A domain. VWA 98.31
PF00092 178 VWA: von Willebrand factor type A domain; InterPro 98.28
cd01474 185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi 98.27
cd01467 180 vWA_BatA_type VWA BatA type: Von Willebrand factor 98.26
COG1240 261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis 98.19
cd01469 177 vWA_integrins_alpha_subunit Integrins are a class 98.17
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.16
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebr 98.09
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was 98.04
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 97.92
cd01457 199 vWA_ORF176_type VWA ORF176 type: Von Willebrand fa 97.87
PRK10997487 yieM hypothetical protein; Provisional 97.76
cd01473 192 vWA_CTRP CTRP for CS protein-TRAP-related protein: 97.69
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V 97.61
PRK15426 570 putative diguanylate cyclase YedQ; Provisional 97.54
cd01452 187 VWA_26S_proteasome_subunit 26S proteasome plays a 97.51
COG2425437 Uncharacterized protein containing a von Willebran 97.47
cd01460 266 vWA_midasin VWA_Midasin: Midasin is a member of th 97.45
PF09967126 DUF2201: VWA-like domain (DUF2201); InterPro: IPR0 97.42
cd01458 218 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter 97.29
PF11775 219 CobT_C: Cobalamin biosynthesis protein CobT VWA do 97.18
PTZ00441 576 sporozoite surface protein 2 (SSP2); Provisional 97.02
PF10138 200 vWA-TerF-like: vWA found in TerF C terminus ; Inte 96.89
PF05762 222 VWA_CoxE: VWA domain containing CoxE-like protein; 96.33
cd01468 239 trunk_domain trunk domain. COPII-coated vesicles c 96.17
cd00181140 TarH Taxis toward Aspartate and Related amino acid 96.15
cd01478 267 Sec23-like Sec23-like: Protein and membrane traffi 95.87
TIGR01651 600 CobT cobaltochelatase, CobT subunit. This model de 95.83
PF04811 243 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I 95.74
cd01479 244 Sec24-like Sec24-like: Protein and membrane traffi 94.95
COG4547 620 CobT Cobalamin biosynthesis protein CobT (nicotina 94.85
PF03731 224 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; Inte 94.78
cd01455 191 vWA_F11C1-5a_type Von Willebrand factor type A (vW 94.78
PLN00162 761 transport protein sec23; Provisional 94.59
COG2304 399 Uncharacterized protein containing a von Willebran 94.34
PRK05325 401 hypothetical protein; Provisional 93.87
smart00319135 TarH Homologues of the ligand binding domain of Ta 93.74
COG1721 416 Uncharacterized conserved protein (some members co 93.71
TIGR02877 371 spore_yhbH sporulation protein YhbH. This protein 92.82
PF04285 421 DUF444: Protein of unknown function (DUF444); Inte 92.66
KOG3768|consensus 888 91.2
PF11443 534 DUF2828: Domain of unknown function (DUF2828); Int 90.06
TIGR00578 584 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit 89.85
KOG4465|consensus 598 88.06
COG2718 423 Uncharacterized conserved protein [Function unknow 87.23
COG4867 652 Uncharacterized protein with a von Willebrand fact 86.76
COG3864396 Uncharacterized protein conserved in bacteria [Fun 86.12
PTZ00395 1560 Sec24-related protein; Provisional 85.53
smart00187 423 INB Integrin beta subunits (N-terminal portion of 84.94
KOG1985|consensus 887 83.55
COG3552 395 CoxE Protein containing von Willebrand factor type 80.32
>KOG2353|consensus Back     alignment and domain information 
Probab=99.95  E-value=4.4e-29  Score=218.75  Aligned_cols=136  Identities=50%  Similarity=0.848  Sum_probs=130.7

Q ss_pred             CCCHHHHHhhhchHHHHHHHHHHhhcCcceeEeeeecccccEEECCCCCCCCc----cccccccccchhhhhhccccccE
Q psy9195           2 AEHDDVRAGLMWSEGLDEVFRENYMADPTLLWQYFGSAKGFLRTYPDKEDAPA----EDLIFDCRNRQWYIQATTCSKDV   77 (139)
Q Consensus         2 ~~~~~v~~~~~~~~~l~~~f~~~~~~~~~i~~~y~gs~~G~~~~~p~~~~~~~----~~~~yDpr~r~Wy~~a~~~~~~v   77 (139)
                      .++|+|+++++||+.|+..|+++.+.+|.+.|||||+..|..+.||+.+|..+    ..+.||+|.|+||.++..+|+++
T Consensus       149 ~~~~~vl~~~~WS~~ld~vf~~N~~~dP~l~wQ~Fgs~tG~~R~yPa~~W~~~~~~~~idl~D~R~r~Wyi~aAt~pKdi  228 (1104)
T KOG2353|consen  149 DRSPDVLNAIDWSEHLDFVFRDNRESDPTLSWQYFGSATGLLRYYPAAAWFDNNTDNSIDLYDCRNRSWYIQAATSPKDI  228 (1104)
T ss_pred             ccCHHHHhhcccccchhHHHhhccccCchhhHHHhhhhhhhhhhCCCccCccCCCCCcceeeecccccccccccCCccce
Confidence            46899999999999999999999999999999999999999999999999742    46789999999999999999999


Q ss_pred             EEEEcCCCCCCCchHHHHHHHHHHHHhhCCCCCEEEEEEeCCceeeeeecCCCCeeeeccc
Q psy9195          78 VILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTLR  138 (139)
Q Consensus        78 vi~iD~sgSm~g~~l~~ak~~~~~~l~~l~~~d~~~v~~f~~~~~~~~~~~~~~~lv~a~~  138 (139)
                      +|++|.||||.|.++.++|..+..+|++|+++|+|++++|+..+..+.||+++ +|||||+
T Consensus       229 viLlD~SgSm~g~~~~lak~tv~~iLdtLs~~Dfvni~tf~~~~~~v~pc~~~-~lvqAt~  288 (1104)
T KOG2353|consen  229 VILLDVSGSMSGLRLDLAKQTVNEILDTLSDNDFVNILTFNSEVNPVSPCFNG-TLVQATM  288 (1104)
T ss_pred             EEEEeccccccchhhHHHHHHHHHHHHhcccCCeEEEEeeccccCcccccccC-ceeecch
Confidence            99999999999999999999999999999999999999999999999999999 9999996

>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>PF08399 VWA_N: VWA N-terminal; InterPro: IPR013608 This domain is found at the N terminus of proteins containing von Willebrand factor type A (VWA, IPR002035 from INTERPRO) and Cache (IPR004010 from INTERPRO) domains Back     alignment and domain information
>PF13768 VWA_3: von Willebrand factor type A domain Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>TIGR03788 marine_srt_targ marine proteobacterial sortase target protein Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK10997 yieM hypothetical protein; Provisional Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>PRK15426 putative diguanylate cyclase YedQ; Provisional Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family Back     alignment and domain information
>PF09967 DUF2201: VWA-like domain (DUF2201); InterPro: IPR018698 This family of various hypothetical bacterial proteins has no known function Back     alignment and domain information
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain Back     alignment and domain information
>PF11775 CobT_C: Cobalamin biosynthesis protein CobT VWA domain Back     alignment and domain information
>PTZ00441 sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts Back     alignment and domain information
>PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown Back     alignment and domain information
>cd01468 trunk_domain trunk domain Back     alignment and domain information
>cd00181 TarH Taxis toward Aspartate and Related amino acids and Homologs (TarH) Back     alignment and domain information
>cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>TIGR01651 CobT cobaltochelatase, CobT subunit Back     alignment and domain information
>PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] Back     alignment and domain information
>cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>COG4547 CobT Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>PF03731 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; InterPro: IPR005161 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PLN00162 transport protein sec23; Provisional Back     alignment and domain information
>COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK05325 hypothetical protein; Provisional Back     alignment and domain information
>smart00319 TarH Homologues of the ligand binding domain of Tar Back     alignment and domain information
>COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only] Back     alignment and domain information
>TIGR02877 spore_yhbH sporulation protein YhbH Back     alignment and domain information
>PF04285 DUF444: Protein of unknown function (DUF444); InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56 Back     alignment and domain information
>KOG3768|consensus Back     alignment and domain information
>PF11443 DUF2828: Domain of unknown function (DUF2828); InterPro: IPR024553 This uncharacterised domain is found in eukaryotic, bacterial and viral proteins Back     alignment and domain information
>TIGR00578 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit (ku70) Back     alignment and domain information
>KOG4465|consensus Back     alignment and domain information
>COG2718 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG3864 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PTZ00395 Sec24-related protein; Provisional Back     alignment and domain information
>smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) Back     alignment and domain information
>KOG1985|consensus Back     alignment and domain information
>COG3552 CoxE Protein containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
4fx5_A 464 VON willebrand factor type A; structural genomics, 2e-06
2x31_A 189 Magnesium-chelatase 60 kDa subunit; ligase, bacter 3e-04
>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Length = 464 Back     alignment and structure
 Score = 45.0 bits (106), Expect = 2e-06
 Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 2/56 (3%)

Query: 74  SKDVVILVDNSGSM--AGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPC 127
               VI++D SGSM     +   AK      + T ++  F  +         + P 
Sbjct: 77  ENVEVIIIDCSGSMDYPRTKMMAAKEATKVAIDTLTDGAFFAVVAGTEGARVVYPT 132
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Length = 189 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
4fx5_A 464 VON willebrand factor type A; structural genomics, 98.94
2x31_A 189 Magnesium-chelatase 60 kDa subunit; ligase, bacter 98.85
3ibs_A 218 Conserved hypothetical protein BATB; structural ge 98.77
3zqk_A 199 VON willebrand factor; blood clotting, adamts-13, 98.74
1ijb_A 202 VON willebrand factor; dinucleotide-binding fold, 98.74
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hy 98.7
1atz_A 189 VON willebrand factor; collagen-binding, hemostasi 98.68
1mf7_A 194 Integrin alpha M; cell adhesion; 1.25A {Homo sapie 98.66
1mjn_A 179 Integrin alpha-L; rossmann fold, immune system; 1. 98.62
1n3y_A 198 Integrin alpha-X; alpha/beta rossmann fold, cell a 98.6
4hqf_A 281 Thrombospondin-related anonymous protein, trap; ma 98.6
1q0p_A 223 Complement factor B; VON willebrand factor, MAC-1, 98.55
4hqo_A 266 Sporozoite surface protein 2; malaria, gliding mot 98.54
2odp_A 509 Complement C2; C3/C5 convertase, complement serin 98.52
1v7p_C 200 Integrin alpha-2; snake venom, C-type lectin, anta 98.46
1shu_X 182 Anthrax toxin receptor 2; alpha/beta rossmann fold 98.42
1pt6_A 213 Integrin alpha-1; cell adhesion; 1.87A {Homo sapie 98.42
3n2n_F 185 Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho 98.41
2b2x_A 223 Integrin alpha-1; computational design, antibody-a 98.38
3rag_A242 Uncharacterized protein; structural genomics, PSI- 98.37
3hrz_D 741 Complement factor B; serine protease, glycosilated 98.23
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 98.19
2ww8_A 893 RRGA, cell WALL surface anchor family protein; IGG 98.07
2x5n_A 192 SPRPN10, 26S proteasome regulatory subunit RPN10; 98.05
4b4t_W 268 RPN10, 26S proteasome regulatory subunit RPN10; hy 98.0
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule 97.99
1jey_B 565 KU80; double-strand DNA break repair, non-homologo 97.48
1yvr_A 538 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 96.7
1jey_A 609 KU70; double-strand DNA break repair, non-homologo 96.63
4dah_A217 Sporulation kinase D; alpha-beta-alpha structure, 96.48
3e4o_A305 C4-dicarboxylate transport sensor protein DCTB; PA 96.21
3by9_A260 Sensor protein; histidine kinase sensor domain, ph 96.16
2nvo_A 535 RO sixty-related protein, RSR; alpha helical repea 96.12
3lif_A254 Putative diguanylate cyclase (ggdef) with PAS/PAC; 95.43
2nut_A 769 Protein transport protein SEC23A; human copii SEC2 95.42
3lid_A 295 Putative sensory BOX/ggdef family protein; PDC fol 95.12
1m2o_A 768 SEC23, protein transport protein SEC23, SEC23P; zi 94.7
2iue_A 212 Pactolus I-domain; membrane protein, CD, ITC, limb 94.62
3c8c_A240 Methyl-accepting chemotaxis protein; structural ge 94.34
3lic_A274 Sensor protein; PDC fold, ATP-binding, kinase, nuc 93.76
1pcx_A 810 Protein transport protein SEC24; 2.50A {Saccharomy 93.68
3efo_B 770 SEC24 related gene family, member D; copii, coat p 91.99
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 91.9
3eh2_A 766 Protein transport protein SEC24C; copii-coat prote 91.4
3lib_A290 Hypothetical sensory transduction histidine kinas; 90.8
3t3p_B 472 Integrin beta-3; integrin, cell adhesion, blood cl 90.38
3v4v_B 503 Integrin beta-7; cell adhesion, madcam-1, membrane 89.98
3eh1_A 751 Protein transport protein SEC24B; copii coat prote 89.9
3vi3_B 454 Integrin beta-1; beta propeller fold, rossman fold 89.71
3li9_A291 Hypothetical sensory transduction histidine kinas; 89.52
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 89.41
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 89.19
2bas_A431 YKUI protein; EAL domain, structural genom protein 87.18
>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Back     alignment and structure
Probab=98.94  E-value=1.6e-09  Score=88.53  Aligned_cols=63  Identities=22%  Similarity=0.298  Sum_probs=56.9

Q ss_pred             ccccEEEEEcCCCCCC--CchHHHHHHHHHHHHhhCCCCCEEEEEEeCCceeeeeecCCCCeeeecc
Q psy9195          73 CSKDVVILVDNSGSMA--GMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLGNYSLVQTL  137 (139)
Q Consensus        73 ~~~~vvi~iD~sgSm~--g~~l~~ak~~~~~~l~~l~~~d~~~v~~f~~~~~~~~~~~~~~~lv~a~  137 (139)
                      .+.+++|+||+||||.  +.+++.+|.++..+++.|.++|+|+|+.|++.+..++|+...  |++++
T Consensus        76 ~~~dvv~VLD~SGSM~~~~~rl~~ak~a~~~ll~~L~~~drv~lV~Fs~~a~~~~p~t~~--l~~~~  140 (464)
T 4fx5_A           76 SENVEVIIIDCSGSMDYPRTKMMAAKEATKVAIDTLTDGAFFAVVAGTEGARVVYPTGGQ--LLRAD  140 (464)
T ss_dssp             CCEEEEEEEECCGGGGTTTHHHHHHHHHHHHHHHHSCTTCEEEEEEESSSEEEEESSSSS--CEECS
T ss_pred             CCceEEEEEEcCcccCCCCchHHHHHHHHHHHHHhCCCCCEEEEEEEcCceEEEecCCcc--cccCC
Confidence            4578999999999999  999999999999999999999999999999999999998754  55554
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
>1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* Back     alignment and structure
>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A Back     alignment and structure
>1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B Back     alignment and structure
>3e4o_A C4-dicarboxylate transport sensor protein DCTB; PAS domain, N-TERM helical dimerization domain, transferase; 2.30A {Sinorhizobium meliloti} PDB: 3e4p_A 3e4q_A 2zbb_A Back     alignment and structure
>3by9_A Sensor protein; histidine kinase sensor domain, phosphoprotein, transferase, two-component regulatory system; 1.70A {Vibrio cholerae} Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure
>3lif_A Putative diguanylate cyclase (ggdef) with PAS/PAC; PDC fold, signaling protein; HET: CIT; 2.70A {Rhodopseudomonas palustris} Back     alignment and structure
>2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A Back     alignment and structure
>3lid_A Putative sensory BOX/ggdef family protein; PDC fold, signaling protein; 1.76A {Vibrio parahaemolyticus} PDB: 3lie_A 2p7j_A* Back     alignment and structure
>1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* Back     alignment and structure
>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Back     alignment and structure
>3c8c_A Methyl-accepting chemotaxis protein; structural genomics, unknown function, uncharacterized protein; 1.50A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>3lic_A Sensor protein; PDC fold, ATP-binding, kinase, nucleotide-binding, phosphopr transferase, transmembrane; 2.30A {Shewanella oneidensis} Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Back     alignment and structure
>3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Back     alignment and structure
>3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} Back     alignment and structure
>3lib_A Hypothetical sensory transduction histidine kinas; PDC fold, signaling protein; 2.99A {Methanosarcina mazei} Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Back     alignment and structure
>3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B Back     alignment and structure
>3vi3_B Integrin beta-1; beta propeller fold, rossman fold, beta sandwich, fibronecti receptor, cell adhesion-immune system complex; HET: NAG BMA MAN; 2.90A {Homo sapiens} PDB: 3vi4_B* Back     alignment and structure
>3li9_A Hypothetical sensory transduction histidine kinas; PDC fold, signaling protein; HET: BTB; 1.70A {Methanosarcina mazei} PDB: 3li8_A* 3lia_A* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2bas_A YKUI protein; EAL domain, structural genom protein structure initiative, midwest center for structural genomics, MCSG, signaling protein; 2.61A {Bacillus subtilis} SCOP: c.1.33.1 d.110.6.2 PDB: 2w27_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1shux_ 181 c.62.1.1 (X:) Capillary morphogenesis protein 2 do 2e-05
d1q0pa_ 209 c.62.1.1 (A:) Complement factor B domain {Human (H 4e-05
d1ijba_ 202 c.62.1.1 (A:) von Willebrand factor A1 domain, vWA 7e-04
d1n3ya_ 189 c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo 0.001
d1atza_ 184 c.62.1.1 (A:) von Willebrand factor A3 domain, vWA 0.003
d1mf7a_ 194 c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, M 0.003
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Integrin A (or I) domain
domain: Capillary morphogenesis protein 2 domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.3 bits (93), Expect = 2e-05
 Identities = 13/68 (19%), Positives = 26/68 (38%), Gaps = 2/68 (2%)

Query: 72  TCSK--DVVILVDNSGSMAGMRNTTAKLVLHSLLQTFSNNDFINIFKFNLTVDTIVPCLG 129
           +C +  D+  ++D SGS+A         V     +  S    ++   F+     I+P  G
Sbjct: 1   SCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTG 60

Query: 130 NYSLVQTL 137
           +   +   
Sbjct: 61  DRGKISKG 68
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 202 Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1q0pa_ 209 Complement factor B domain {Human (Homo sapiens) [ 98.51
d1mf7a_ 194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub 98.44
d1n3ya_ 189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI 98.41
d1jeyb2 236 Ku80 subunit N-terminal domain {Human (Homo sapien 98.4
d1jeya2 220 Ku70 subunit N-terminal domain {Human (Homo sapien 98.36
d1atza_ 184 von Willebrand factor A3 domain, vWA3 {Human (Homo 98.32
d1mjna_ 179 Integrin CD11a/CD18 (Leukocyte function associated 98.31
d1shux_ 181 Capillary morphogenesis protein 2 domain {Human (H 98.31
d1ijba_ 202 von Willebrand factor A1 domain, vWA1 {Human (Homo 98.15
d1v7pc_ 193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId 97.94
d1yvra2174 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c 97.91
d1pt6a_ 192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId 97.87
d1tyeb2 248 Integrin beta A domain {Human (Homo sapiens) [TaxI 96.54
d2qtva3 271 Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T 96.05
d2p7ja2172 GGDEF family protein VP0354 {Vibrio parahaemolytic 95.83
d1pd0a3 252 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 94.44
d2basa2145 Hypothetical protein YkuI, C-terminal domain {Baci 93.55
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Integrin A (or I) domain
domain: Complement factor B domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.51  E-value=9.9e-08  Score=67.10  Aligned_cols=55  Identities=16%  Similarity=0.183  Sum_probs=48.5

Q ss_pred             ccEEEEEcCCCCCCCchHHHHHHHHHHHHhhCC---CCCEEEEEEeCCceeeeeecCC
Q psy9195          75 KDVVILVDNSGSMAGMRNTTAKLVLHSLLQTFS---NNDFINIFKFNLTVDTIVPCLG  129 (139)
Q Consensus        75 ~~vvi~iD~sgSm~g~~l~~ak~~~~~~l~~l~---~~d~~~v~~f~~~~~~~~~~~~  129 (139)
                      -+++|++|.||||.+.+++.+|.+++.+++.|.   .+.+|+|+.|++.++..+|...
T Consensus         2 lDivfvlD~SgSm~~~~~~~~k~~~~~li~~l~~~~~~~rv~lv~f~~~~~~~~~l~~   59 (209)
T d1q0pa_           2 MNIYLVLDGSDSIGASNFTGAKKSLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSE   59 (209)
T ss_dssp             EEEEEEEECSTTTCHHHHHHHHHHHHHHHHHHHTTTCCCEEEEEEESSSEEEEECTTS
T ss_pred             cCEEEEEeCCCCCChHHHHHHHHHHHHHHHhcccCCCCcEEEEEEecCceeEEecCcc
Confidence            368999999999999999999999999998874   6779999999999998887643
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p7ja2 d.110.6.2 (A:9-180) GGDEF family protein VP0354 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2basa2 d.110.6.2 (A:263-407) Hypothetical protein YkuI, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure