Diaphorina citri psyllid: psy9197


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MAPPKLATDKRTLDKTWKLMDKVVKLCQHPKMNLKNSPPFLLDILPDTYQRLKLIYTKYEDKMIVLHNNEFFNVFIVNLMRKCKQAIKLFKEGKEKMYDESSHYRRNLTKLSLVFSHMLSELKAIFPNGVFAGDQFRITKSDAADFWRNNFGNA
cccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccCCcccccCCccccHHHHHHHHcccc
*********KRTLDKTWKLMDKVVKLCQHPKMNLKNSPPFLLDILPDTYQRLKLIYTKYEDKMIVLHNNEFFNVFIVNLMRKCKQAIKLFKEGKEKMYDESSHYRRNLTKLSLVFSHMLSELKAIFPNGVFAGDQFRITKSDAADFWRNNFG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPPKLATDKRTLDKTWKLMDKVVKLCQHPKMNLKNSPPFLLDILPDTYQRLKLIYTKYEDKMIVLHNNEFFNVFIVNLMRKCKQAIKLFKEGKEKMYDESSHYRRNLTKLSLVFSHMLSELKAIFPNGVFAGDQFRITKSDAADFWRNNFGNA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase CBL-B E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome.confidentQ6DFR2
E3 ubiquitin-protein ligase CBL-B E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Negatively regulates TCR (T-cell receptor), BCR (B-cell receptor) and FCER1 (high affinity immunoglobulin epsilon receptor) signal transduction pathways. In naive T-cells, inhibits VAV1 activation upon TCR engagement and imposes a requirement for CD28 costimulation for proliferation and IL-2 production. Also acts by promoting PIK3R1/p85 ubiquitination, which impairs its recruitment to the TCR and subsequent activation. In activated T-cells, inhibits PLCG1 activation and calcium mobilization upon restimulation and promotes anergy. In B-cells, acts by ubiquitinating SYK and promoting its proteasomal degradation. May also be involved in EGFR ubiquitination and internalization.confidentQ3TTA7
E3 ubiquitin-protein ligase CBL-B E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Negatively regulates TCR (T-cell receptor), BCR (B-cell receptor) and FCER1 (high affinity immunoglobulin epsilon receptor) signal transduction pathways. In naive T-cells, inhibits VAV1 activation upon TCR engagement and imposes a requirement for CD28 costimulation for proliferation and IL-2 production. Also acts by promoting PIK3R1/p85 ubiquitination, which impairs its recruitment to the TCR and subsequent activation. In activated T-cells, inhibits PLCG1 activation and calcium mobilization upon restimulation and promotes anergy. In B-cells, acts by ubiquitinating SYK and promoting its proteasomal degradation. May also be involved in EGFR ubiquitination and internalization.confidentQ8K4S7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007465 [BP]R7 cell fate commitmentprobableGO:0046552, GO:0048749, GO:0044707, GO:0030154, GO:0045466, GO:0009653, GO:0042706, GO:0044699, GO:0001745, GO:0048869, GO:0007275, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0048663, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0001752, GO:0048699, GO:0045165, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010941 [BP]regulation of cell deathprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0008069 [BP]dorsal/ventral axis specification, ovarian follicular epitheliumprobableGO:0016333, GO:0048610, GO:0016334, GO:0060429, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0007163, GO:0009798, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0000003, GO:0003006, GO:0048869, GO:0030707, GO:0007276, GO:0048729, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0002009, GO:0009987, GO:0009888, GO:0044767, GO:0022414, GO:0008150, GO:0003002, GO:0022412, GO:0044702, GO:0009953, GO:0044707, GO:0009950, GO:0048856, GO:0044763
GO:0016600 [CC]flotillin complexprobableGO:0043234, GO:0016020, GO:0032991, GO:0045121, GO:0044464, GO:0005623, GO:0005575, GO:0005901, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0006897 [BP]endocytosisprobableGO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0048134 [BP]germ-line cyst formationprobableGO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0007276, GO:0000003, GO:0048869, GO:0044699, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0008283, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0007281, GO:0044702, GO:0003006, GO:0048856, GO:0044763
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0051246 [BP]regulation of protein metabolic processprobableGO:0080090, GO:0019222, GO:0060255, GO:0008150, GO:0065007, GO:0050789
GO:0001784 [MF]phosphotyrosine bindingprobableGO:0003674, GO:0051219, GO:0005488, GO:0005515, GO:0045309
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0009968 [BP]negative regulation of signal transductionprobableGO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0007173 [BP]epidermal growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0038127
GO:0030971 [MF]receptor tyrosine kinase bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0080134 [BP]regulation of response to stressprobableGO:0008150, GO:0065007, GO:0048583, GO:0050789
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0007298 [BP]border follicle cell migrationprobableGO:0048610, GO:0048870, GO:0030154, GO:0048468, GO:0019953, GO:0006928, GO:0007292, GO:0051674, GO:0007297, GO:0001667, GO:0044699, GO:0000003, GO:0048869, GO:0030707, GO:0051179, GO:0007276, GO:0016477, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0090132, GO:0090130, GO:0040011, GO:0044702, GO:0010631, GO:0044707, GO:0003006, GO:0048856, GO:0044763
GO:0004871 [MF]signal transducer activityprobableGO:0060089, GO:0003674
GO:0033500 [BP]carbohydrate homeostasisprobableGO:0042592, GO:0008150, GO:0065008, GO:0065007, GO:0048878

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BUX, chain B
Confidence level:very confident
Coverage over the Query: 4-154
View the alignment between query and template
View the model in PyMOL