Diaphorina citri psyllid: psy9199

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MTTAGMTTTHSSHSEQEPPPTQTVVPIQNHAPPQPPAHDPEVDIIINNVVCSFSVRCHLNLRQIALNGVNVEYRRENGMVTMKLRKPYTTASIWSSGKITCTGATSEDQSKIAARRYARCLQRLGFKARFTNFRVVNVLGTCSMPFAIRILQFSEKHRAAEYEPELHPGVTYRITRPKATLKIFSTGGITVTACNDSNKIPVQI
cccccccccccccccccccccccccccccccccccccccccccCEEEEEEEEEEEcccccHHHHHHccccEEEEccccEEEEEEccccEEEEECcccEEEEEccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEcccEEEHHHHHHHccccccccccccCEEEEEccccEEEEEEccccEEEEECcccccccccc
*****************************************VDIIINNVVCSFSVRCHLNLRQIALNGVNVEYRRENGMVTMKLRKPYTTASIWSSGKITCTGATSEDQSKIAARRYARCLQRLGFKARFTNFRVVNVLGTCSMPFAIRILQFSEKHRAAEYEPELHPGVTYRITRPKATLKIFSTGGITVTACNDS***PVQI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTAGMTTTHSSHSEQEPPPTQTVVPIQNHAPPQPPAHDPEVDIIINNVVCSFSVRCHLNLRQIALNGVNVEYRRENGMVTMKLRKPYTTASIWSSGKITCTGATSEDQSKIAARRYARCLQRLGFKARFTNFRVVNVLGTCSMPFAIRILQFSEKHRAAEYEPELHPGVTYRITRPKATLKIFSTGGITVTACNDSNKIPVQI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TATA box-binding protein-like protein 1 Does not bind the TATA box. Has DNA-binding ability.confidentP62340
TATA box-binding protein-like protein 1 Does not bind the TATA box. Has DNA-binding ability (By similarity). Members of the TBP family are differentially required to regulate transcription and development during early embryogenesis.confidentQ5U385
TATA box-binding protein-like protein 1 Does not bind the TATA box. Has DNA-binding ability.confidentQ5R7U8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000126 [CC]transcription factor TFIIIB complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0005672 [CC]transcription factor TFIIA complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0007289 [BP]spermatid nucleus differentiationprobableGO:0048610, GO:0048232, GO:0060429, GO:0022412, GO:0048468, GO:0019953, GO:0007276, GO:0044699, GO:0000003, GO:0048869, GO:0071840, GO:0016043, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0009888, GO:0007281, GO:0022414, GO:0007283, GO:0044763, GO:0007286, GO:0006996, GO:0006997, GO:0044702, GO:0003006, GO:0048856, GO:0044767, GO:0030154, GO:0008150
GO:0060261 [BP]positive regulation of transcription initiation from RNA polymerase II promoterprobableGO:0060260, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0051128, GO:0010628, GO:0045935, GO:0050789, GO:0080090, GO:0010604, GO:0006355, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0006357, GO:0065007, GO:0048518, GO:0010468, GO:0051130, GO:2000142, GO:0060255, GO:0009889, GO:0031334, GO:0050794, GO:0008150, GO:0045893, GO:2001141, GO:0043254, GO:0051252, GO:0051254, GO:0044087, GO:0010557, GO:0010556, GO:2000144, GO:0048522
GO:0001092 [MF]TFIIA-class transcription factor bindingprobableGO:0001085, GO:0001091, GO:0008134, GO:0001098, GO:0001099, GO:0003674, GO:0005488, GO:0005515
GO:0070893 [BP]transposon integrationprobableGO:0071704, GO:0006139, GO:0009987, GO:0044260, GO:0044238, GO:0032196, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0015074, GO:0034641, GO:0006807, GO:0044763, GO:1901360, GO:0008152, GO:0006259, GO:0008150, GO:0044699, GO:0046483
GO:0070898 [BP]RNA polymerase III transcriptional preinitiation complex assemblyprobableGO:0022607, GO:0032774, GO:0043933, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:0034622, GO:1901362, GO:1901360, GO:0071824, GO:0006139, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0071840, GO:0065004, GO:0006384, GO:0006383, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0070897, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0044085, GO:0006351, GO:0006352, GO:0019438
GO:0006235 [BP]dTTP biosynthetic processprobableGO:0009148, GO:0009211, GO:0009212, GO:0044238, GO:0009219, GO:0009142, GO:0006139, GO:0009147, GO:0072528, GO:0044249, GO:0034641, GO:0009165, GO:0044281, GO:1901576, GO:1901362, GO:1901360, GO:0072527, GO:0006220, GO:0006221, GO:0044710, GO:0046385, GO:0008150, GO:0071704, GO:0009141, GO:0018130, GO:0009202, GO:0009200, GO:0006725, GO:0009987, GO:0009221, GO:0009058, GO:0009263, GO:0009262, GO:0009117, GO:0008152, GO:0019438, GO:0034654, GO:0044271, GO:0090407, GO:0055086, GO:0046483, GO:1901564, GO:0009265, GO:1901566, GO:1901137, GO:1901135, GO:0009394, GO:0044237, GO:0019692, GO:0006796, GO:0006807, GO:1901293, GO:0006793, GO:0019637, GO:0046075, GO:0006753
GO:0001016 [MF]RNA polymerase III regulatory region DNA bindingprobableGO:0044212, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0008301 [MF]DNA binding, bendingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0001674 [CC]female germ cell nucleusprobableGO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0001675 [BP]acrosome assemblyprobableGO:0022607, GO:0048232, GO:0060429, GO:0022412, GO:0048468, GO:0019953, GO:0010927, GO:0048610, GO:0007276, GO:0009653, GO:0044699, GO:0000003, GO:0048869, GO:0071840, GO:0016043, GO:0032989, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0008150, GO:0007286, GO:0070925, GO:0006996, GO:0007281, GO:0044702, GO:0003006, GO:0048856, GO:0044085, GO:0048646, GO:0030154, GO:0044763
GO:0001673 [CC]male germ cell nucleusprobableGO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0000979 [MF]RNA polymerase II core promoter sequence-specific DNA bindingprobableGO:0044212, GO:0003676, GO:0043565, GO:0001067, GO:0000975, GO:0001012, GO:0000976, GO:0000977, GO:0001047, GO:0001046, GO:0003674, GO:0097159, GO:0003677, GO:1901363, GO:0005488
GO:0001075 [MF]RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity involved in preinitiation complex assemblyprobableGO:0003700, GO:0003674, GO:0000983, GO:0001071, GO:0000981
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0000500 [CC]RNA polymerase I upstream activating factor complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0044446, GO:0000120, GO:0031981, GO:0005730, GO:0005634, GO:0005654, GO:0044451, GO:0044452, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0070860 [CC]RNA polymerase I core factor complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0044446, GO:0000120, GO:0031981, GO:0005730, GO:0005634, GO:0005654, GO:0044451, GO:0044452, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0005669 [CC]transcription factor TFIID complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YTB, chain A
Confidence level:very confident
Coverage over the Query: 41-202
View the alignment between query and template
View the model in PyMOL
Template: 3EIK, chain A
Confidence level:very confident
Coverage over the Query: 41-202
View the alignment between query and template
View the model in PyMOL