Diaphorina citri psyllid: psy9200


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MSIPILSSIPHTKRIHNCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYHYSKSK
ccccccccccccccCECcccccCEEEccccccccccEEEEEEEEEEEEcccccEEEccccccCEEEEEEEcccccEEEEEEEEECccccccccEEEEEEEccccccEECcccccEEEccc
***********TKRIHNCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYHYS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIPILSSIPHTKRIHNCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYHYSKSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein enabled homolog Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. ENAH induces the formation of F-actin rich outgrowths in fibroblasts. Acts synergistically with BAIAP2-alpha and downstream of NTN1 to promote filipodia formation. Required for actin-based mobility of Listeria monocytogenes.confidentQ03173
Protein enabled homolog Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. ENAH induces the formation of F-actin rich outgrowths in fibroblasts. Acts synergistically with BAIAP2-alpha and downstream of NTN1 to promote filipodia formation. Required for the actin-based mobility of Listeria monocytogenes.confidentQ8N8S7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032433 [CC]filopodium tipprobableGO:0005575, GO:0044463, GO:0044464, GO:0005623, GO:0030175, GO:0042995
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0006928 [BP]cellular component movementprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0008154 [BP]actin polymerization or depolymerizationprobableGO:0006996, GO:0007015, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0005522 [MF]profilin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0017124 [MF]SH3 domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0001725 [CC]stress fiberprobableGO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EVH, chain A
Confidence level:very confident
Coverage over the Query: 33-120
View the alignment between query and template
View the model in PyMOL
Template: 2IFS, chain A
Confidence level:probable
Coverage over the Query: 2-119
View the alignment between query and template
View the model in PyMOL