Psyllid ID: psy9200


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MSIPILSSIPHTKRIHNCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYHYSKSK
ccccccccccccccEEEcccccEEEEccccccccccEEEEEEEEEEEEcccccEEEccccccEEEEEEEEcccccEEEEEEEEEEccccccccEEEEEEEccccccEEEcccccEEEccc
cccccccccccccccEcccccccEEEcccccccEEEEEEEEEEEEEEEccccEEEEHHHccccEEEEEEEEccccEEEEEEEEccccccccccEEEEEEEEccccEEccccccccccccc
msipilssiphtkrihncdssyvatvntshyatEQSIASARASVMIYDdvnkkwipsgsssglskVHVFQHQVNNTFRVVGRklqnqeykadytvsinipnkkgsnmnitITSYHYSKSK
msipilssiphtkrihnCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKAdytvsinipnkkgsnmnititsyhysksk
MSIPILSSIPHTKRIHNCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYHYSKSK
***********TKRIHNCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNK***NMNITITSY******
*********************************EQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYHYS***
MSIPILSSIPHTKRIHNCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYHYSKSK
*S**ILSSIPHTKRIHNCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSY******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIPILSSIPHTKRIHNCDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYHYSKSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query120 2.2.26 [Sep-21-2011]
Q8T4F7 980 Protein enabled OS=Drosop no N/A 0.791 0.096 0.509 4e-20
Q03173 802 Protein enabled homolog O yes N/A 0.641 0.096 0.518 2e-19
Q8N8S7 591 Protein enabled homolog O yes N/A 0.641 0.130 0.518 2e-17
Q64GL0 692 Ena/VASP-like protein OS= N/A N/A 0.641 0.111 0.440 2e-13
Q5R896 422 Ena/VASP-like protein OS= no N/A 0.641 0.182 0.416 2e-12
Q9UI08 416 Ena/VASP-like protein OS= no N/A 0.641 0.185 0.416 2e-12
O08719 393 Ena/VASP-like protein OS= no N/A 0.641 0.195 0.416 2e-12
P70429 414 Ena/VASP-like protein OS= no N/A 0.641 0.185 0.404 9e-12
P50552 380 Vasodilator-stimulated ph no N/A 0.65 0.205 0.392 2e-10
P70460 375 Vasodilator-stimulated ph no N/A 0.65 0.208 0.392 5e-10
>sp|Q8T4F7|ENA_DROME Protein enabled OS=Drosophila melanogaster GN=ena PE=1 SV=4 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 64/104 (61%), Gaps = 9/104 (8%)

Query: 13  KRIHN-CDSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQH 71
           +R HN     ++  + T     EQSI  ARASVM+YDD  KKW+PSGSSSGLSKV ++ H
Sbjct: 279 QRRHNSVKDKFIGGITT--IFAEQSIIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYHH 336

Query: 72  QVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYH 115
           Q NNTFRVVGRKLQ      D+ V IN    KG   N    ++H
Sbjct: 337 QQNNTFRVVGRKLQ------DHEVVINCSILKGLKYNQATATFH 374




Functions, together with Abl, trio and fra, in a complex signaling network that regulates axon guidance at the CNS midline. Required in part for robo-mediated repulsive axon guidance. May be involved in lamellipodial dynamics.
Drosophila melanogaster (taxid: 7227)
>sp|Q03173|ENAH_MOUSE Protein enabled homolog OS=Mus musculus GN=Enah PE=1 SV=2 Back     alignment and function description
>sp|Q8N8S7|ENAH_HUMAN Protein enabled homolog OS=Homo sapiens GN=ENAH PE=1 SV=2 Back     alignment and function description
>sp|Q64GL0|EVL_XENLA Ena/VASP-like protein OS=Xenopus laevis GN=evl PE=2 SV=1 Back     alignment and function description
>sp|Q5R896|EVL_PONAB Ena/VASP-like protein OS=Pongo abelii GN=EVL PE=2 SV=1 Back     alignment and function description
>sp|Q9UI08|EVL_HUMAN Ena/VASP-like protein OS=Homo sapiens GN=EVL PE=1 SV=2 Back     alignment and function description
>sp|O08719|EVL_RAT Ena/VASP-like protein OS=Rattus norvegicus GN=Evl PE=2 SV=1 Back     alignment and function description
>sp|P70429|EVL_MOUSE Ena/VASP-like protein OS=Mus musculus GN=Evl PE=1 SV=2 Back     alignment and function description
>sp|P50552|VASP_HUMAN Vasodilator-stimulated phosphoprotein OS=Homo sapiens GN=VASP PE=1 SV=3 Back     alignment and function description
>sp|P70460|VASP_MOUSE Vasodilator-stimulated phosphoprotein OS=Mus musculus GN=Vasp PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
91079832 454 PREDICTED: similar to vasodilator-stimul 0.666 0.176 0.627 9e-22
307194686 599 Protein enabled [Harpegnathos saltator] 0.641 0.128 0.626 2e-20
350427792 770 PREDICTED: hypothetical protein LOC10074 0.633 0.098 0.621 3e-20
110762993 772 PREDICTED: hypothetical protein LOC72723 0.633 0.098 0.621 4e-20
340724011 769 PREDICTED: hypothetical protein LOC10064 0.633 0.098 0.621 4e-20
312375421 298 hypothetical protein AND_14197 [Anophele 0.683 0.275 0.602 4e-20
383854802 785 PREDICTED: uncharacterized protein LOC10 0.633 0.096 0.621 5e-20
321466872151 hypothetical protein DAPPUDRAFT_213242 [ 0.641 0.509 0.602 8e-20
158289718 646 AGAP010673-PA [Anopheles gambiae str. PE 0.641 0.119 0.614 8e-20
170037774 271 vasodilator-stimulated phosphoprotein [C 0.691 0.306 0.584 1e-19
>gi|91079832|ref|XP_970236.1| PREDICTED: similar to vasodilator-stimulated phosphoprotein [Tribolium castaneum] gi|270003288|gb|EEZ99735.1| hypothetical protein TcasGA2_TC002504 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  107 bits (267), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 54/86 (62%), Positives = 62/86 (72%), Gaps = 6/86 (6%)

Query: 30  HYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEY 89
           ++  EQSIASARASVMIYDDVNKKWIPSG+SSGLSKVH++QH V  TFRVVGRKLQ    
Sbjct: 31  YWNCEQSIASARASVMIYDDVNKKWIPSGTSSGLSKVHIYQHTVQQTFRVVGRKLQ---- 86

Query: 90  KADYTVSINIPNKKGSNMNITITSYH 115
             D+ V IN    KG   N    ++H
Sbjct: 87  --DHEVVINCAILKGLKYNQATATFH 110




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307194686|gb|EFN76945.1| Protein enabled [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350427792|ref|XP_003494883.1| PREDICTED: hypothetical protein LOC100744390 [Bombus impatiens] Back     alignment and taxonomy information
>gi|110762993|ref|XP_001122945.1| PREDICTED: hypothetical protein LOC727235 [Apis mellifera] Back     alignment and taxonomy information
>gi|340724011|ref|XP_003400379.1| PREDICTED: hypothetical protein LOC100647911 [Bombus terrestris] Back     alignment and taxonomy information
>gi|312375421|gb|EFR22800.1| hypothetical protein AND_14197 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|383854802|ref|XP_003702909.1| PREDICTED: uncharacterized protein LOC100875902 [Megachile rotundata] Back     alignment and taxonomy information
>gi|321466872|gb|EFX77865.1| hypothetical protein DAPPUDRAFT_213242 [Daphnia pulex] Back     alignment and taxonomy information
>gi|158289718|ref|XP_559175.3| AGAP010673-PA [Anopheles gambiae str. PEST] gi|157018462|gb|EAL41069.3| AGAP010673-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170037774|ref|XP_001846730.1| vasodilator-stimulated phosphoprotein [Culex quinquefasciatus] gi|167881134|gb|EDS44517.1| vasodilator-stimulated phosphoprotein [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
FB|FBgn0000578 980 ena "enabled" [Drosophila mela 0.791 0.096 0.519 1.4e-18
UNIPROTKB|Q9DEG2 513 avenaII "Uncharacterized prote 0.641 0.150 0.518 1.8e-17
UNIPROTKB|E1BYW0 515 ENAH "Uncharacterized protein" 0.641 0.149 0.518 1.8e-17
RGD|1307666 526 Enah "enabled homolog (Drosoph 0.641 0.146 0.518 1.9e-17
UNIPROTKB|O93263 550 ENAH "Avena" [Gallus gallus (t 0.641 0.14 0.518 2.1e-17
UNIPROTKB|E1BYV9 552 ENAH "Uncharacterized protein" 0.641 0.139 0.518 2.1e-17
UNIPROTKB|Q8N8S7 591 ENAH "Protein enabled homolog" 0.641 0.130 0.518 2.5e-17
UNIPROTKB|F1S8S4 719 ENAH "Uncharacterized protein" 0.641 0.107 0.518 3.5e-17
UNIPROTKB|F1P3F4 784 ENAH "Uncharacterized protein" 0.641 0.098 0.518 4.1e-17
UNIPROTKB|F1N214 798 F1N214 "Uncharacterized protei 0.641 0.096 0.518 4.2e-17
FB|FBgn0000578 ena "enabled" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 236 (88.1 bits), Expect = 1.4e-18, P = 1.4e-18
 Identities = 54/104 (51%), Positives = 66/104 (63%)

Query:    13 KRIHNC-DSSYVATVNTSHYATEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQH 71
             +R HN     ++  + T  +A EQSI  ARASVM+YDD  KKW+PSGSSSGLSKV ++ H
Sbjct:   279 QRRHNSVKDKFIGGITTI-FA-EQSIIGARASVMVYDDNQKKWVPSGSSSGLSKVQIYHH 336

Query:    72 QVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITITSYH 115
             Q NNTFRVVGRKLQ      D+ V IN    KG   N    ++H
Sbjct:   337 QQNNTFRVVGRKLQ------DHEVVINCSILKGLKYNQATATFH 374




GO:0017124 "SH3 domain binding" evidence=IDA;IPI
GO:0007411 "axon guidance" evidence=IGI;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0007409 "axonogenesis" evidence=IMP
GO:0003779 "actin binding" evidence=ISS
GO:0003382 "epithelial cell morphogenesis" evidence=IGI
GO:0030424 "axon" evidence=IDA
GO:0007391 "dorsal closure" evidence=IGI;TAS
GO:0005912 "adherens junction" evidence=IDA
GO:0007010 "cytoskeleton organization" evidence=TAS
GO:0008064 "regulation of actin polymerization or depolymerization" evidence=TAS
GO:0005911 "cell-cell junction" evidence=IDA
GO:0007015 "actin filament organization" evidence=IMP
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0030027 "lamellipodium" evidence=IDA
GO:0007390 "germ-band shortening" evidence=IMP
GO:0008258 "head involution" evidence=IMP
GO:0051491 "positive regulation of filopodium assembly" evidence=IMP
GO:0032433 "filopodium tip" evidence=IDA
GO:0031252 "cell leading edge" evidence=IDA
GO:0007396 "suture of dorsal opening" evidence=IMP
GO:0007303 "cytoplasmic transport, nurse cell to oocyte" evidence=IMP
GO:0007298 "border follicle cell migration" evidence=IMP
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0048749 "compound eye development" evidence=IGI
GO:0051489 "regulation of filopodium assembly" evidence=IMP
GO:0010591 "regulation of lamellipodium assembly" evidence=IMP
GO:0060288 "formation of a compartment boundary" evidence=IMP
GO:0035262 "gonad morphogenesis" evidence=IMP
UNIPROTKB|Q9DEG2 avenaII "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYW0 ENAH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1307666 Enah "enabled homolog (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O93263 ENAH "Avena" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYV9 ENAH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N8S7 ENAH "Protein enabled homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8S4 ENAH "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3F4 ENAH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N214 F1N214 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q03173ENAH_MOUSENo assigned EC number0.51800.64160.0960yesN/A
Q8N8S7ENAH_HUMANNo assigned EC number0.51800.64160.1302yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
cd01207108 cd01207, EVH1_Ena_VASP-like, Enabled/VASP family E 5e-27
cd00837102 cd00837, EVH1_family, EVH1 (Drosophila Enabled (En 7e-11
smart00461106 smart00461, WH1, WASP homology region 1 5e-10
pfam00568111 pfam00568, WH1, WH1 domain 5e-09
cd10574113 cd10574, EVH1_SPRED-like, Sprouty-related EVH1 dom 0.001
>gnl|CDD|241243 cd01207, EVH1_Ena_VASP-like, Enabled/VASP family EVH1 domain Back     alignment and domain information
 Score = 95.8 bits (239), Expect = 5e-27
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 6/63 (9%)

Query: 36 SIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTV 95
          S+ASARASVM+YDD NKKW+PSG S GLS+V ++ +  NNTFRVVGRKLQ+ E      V
Sbjct: 1  SVASARASVMVYDDENKKWVPSGGSQGLSRVQIYHNPRNNTFRVVGRKLQDHE------V 54

Query: 96 SIN 98
           IN
Sbjct: 55 VIN 57


Ena/VASP family includes proteins such as: Vasodilator-stimulated phosphoprotein (VASP), enabled gene product from Drosophila (Ena), mammalian enabled (Mena) and Ena/VASP-Like protein (EVL) localize to focal adhesions and to sites of actin filament dynamics. These proteins share a common modular organization with a highly conserved N- and C-terminal domains, termed Ena/VASP homology domains 1 and 2 (EVH1 and EVH2), that are separated by a central proline-rich domain. The EVH1 domain binds to other proteins at proline rich sequences. The majority of Ena-VASP type EVH1 domains recognize FPPPP motifs such as in the focal adhesion proteins zyxin and vinculin, and the ActA surface protein of Listeria monocytogenes, however the LIM3 domain of Tes lacks the FPPPP motif but still binds the EVH1 domain of Mena. It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains. EVH2 mediates oligomerization within the family. The proline-rich region binds SH3 and WW domains as well as profilin, a protein that regulates actin filament dynamics. The EVH1 domains are part of the PH domain superamily. There are 5 EVH1 subfamilies: Enables/VASP, Homer/Vesl, WASP, Dcp1, and Spred. Ligands are known for three of the EVH1 subfamilies, all of which bind proline-rich sequences: the Enabled/VASP family binds to FPPPP peptides, the Homer/Vesl family binds PPxxF peptides, and the WASP family binds LPPPEP peptides. EVH1 has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains. Length = 108

>gnl|CDD|241234 cd00837, EVH1_family, EVH1 (Drosophila Enabled (Ena)/Vasodilator-stimulated phosphoprotein (VASP) homology 1) domain Back     alignment and domain information
>gnl|CDD|214674 smart00461, WH1, WASP homology region 1 Back     alignment and domain information
>gnl|CDD|144235 pfam00568, WH1, WH1 domain Back     alignment and domain information
>gnl|CDD|241310 cd10574, EVH1_SPRED-like, Sprouty-related EVH1 domain-containing-like proteins EVH1 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 120
cd01207111 Ena-Vasp Enabled-VASP-type homology (EVH1) domain. 100.0
cd01206111 Homer Homer type EVH1 domain. Homer type EVH1 doma 100.0
KOG4590|consensus 409 99.93
smart00461106 WH1 WASP homology region 1. Region of the Wiskott- 99.92
cd00837104 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homolog 99.92
PF00568111 WH1: WH1 domain; InterPro: IPR000697 The EVH1 (WH1 99.87
cd00835122 RanBD Ran-binding domain. Ran-binding domain; This 99.06
smart00160130 RanBD Ran-binding domain. Domain of apporximately 99.06
PF00638122 Ran_BP1: RanBP1 domain; InterPro: IPR000156 Ran is 98.37
cd01205105 WASP WASP-type EVH1 domain. WASP-type EVH1 domain. 95.37
>cd01207 Ena-Vasp Enabled-VASP-type homology (EVH1) domain Back     alignment and domain information
Probab=100.00  E-value=3.4e-37  Score=224.18  Aligned_cols=81  Identities=53%  Similarity=0.854  Sum_probs=78.5

Q ss_pred             ccceEEEEEEEEEEeCCCCCeEECCC-CCCeEEEEEEEeCCCCceEEEEeeeccccccccceEEEeeecCCCCeeeeecC
Q psy9200          34 EQSIASARASVMIYDDVNKKWIPSGS-SSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNITIT  112 (120)
Q Consensus        34 E~~I~~vrA~VM~yDd~tk~WvP~gg-~~glS~V~i~~~~~~n~fRIvG~rlqD~~~~~~~~VvINc~I~~~l~Ynkatp  112 (120)
                      |++||++||+||+|||++|+|+|+|| ++|+|+|+||+++.+|+|||||+|++|+      +++|||.|+++|+||+++|
T Consensus         1 e~~i~~~rA~Vm~~d~~tk~W~P~~~~~~~ls~V~~~~~~~~~~yrIvg~~~~~~------~~v~e~~l~~~l~y~k~~p   74 (111)
T cd01207           1 EQSICQARASVMVYDDSNKKWVPAGGGSQGFSRVQIYHHPRNNTFRVVGRKLQDH------QVVINCAIVKGLKYNQATP   74 (111)
T ss_pred             CCceEEEEEEeeEEcCCCCcEEcCCCCCCCcceEEEEEcCCCCEEEEEEeecCCC------cEEEEEEecCCceeeecCC
Confidence            89999999999999999999999997 5699999999999999999999999999      9999999999999999999


Q ss_pred             cceeeccC
Q psy9200         113 SYHYSKSK  120 (120)
Q Consensus       113 tFHqWrD~  120 (120)
                      +||||+|.
T Consensus        75 ~Fh~w~~~   82 (111)
T cd01207          75 TFHQWRDA   82 (111)
T ss_pred             cceeeecC
Confidence            99999984



Enabled-VASP-type homology (EVH1) domain. The EVH1 domain binds to other proteins at proline rich sequences. It is found in proteins involved in cytoskeletal reorganization such as Enabled and VASP. Ena-VASP type EVH1 domains specifically recognize FPPPP motifs in the focal adhesion proteins zyxin and vinculin, and the ActA surface protein of Listeria monocytogenes. It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.

>cd01206 Homer Homer type EVH1 domain Back     alignment and domain information
>KOG4590|consensus Back     alignment and domain information
>smart00461 WH1 WASP homology region 1 Back     alignment and domain information
>cd00837 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain Back     alignment and domain information
>PF00568 WH1: WH1 domain; InterPro: IPR000697 The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events Back     alignment and domain information
>cd00835 RanBD Ran-binding domain Back     alignment and domain information
>smart00160 RanBD Ran-binding domain Back     alignment and domain information
>PF00638 Ran_BP1: RanBP1 domain; InterPro: IPR000156 Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm Back     alignment and domain information
>cd01205 WASP WASP-type EVH1 domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
2xqn_M119 Complex Of The 2nd And 3rd Lim Domains Of Tes With 3e-20
1evh_A112 Evh1 Domain From Murine Enabled In Complex With Act 3e-20
2iyb_A114 Structure Of Complex Between The 3rd Lim Domain Of 4e-20
1egx_A115 Solution Structure Of The Ena-Vasp Homology 1 (Evh1 8e-12
1qc6_A130 Evh1 Domain From EnaVASP-Like Protein In Complex Wi 8e-12
>pdb|2XQN|M Chain M, Complex Of The 2nd And 3rd Lim Domains Of Tes With The Evh1 Domain Of Mena And The N-Terminal Domain Of Actin-Like Protein Arp7a Length = 119 Back     alignment and structure

Iteration: 1

Score = 93.6 bits (231), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 43/83 (51%), Positives = 56/83 (67%), Gaps = 6/83 (7%) Query: 33 TEQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKAD 92 +EQSI ARA+VM+YDD NKKW+P+G S+G S+VH++ H NNTFRVVGRK+Q D Sbjct: 5 SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQ------D 58 Query: 93 YTVSINIPNKKGSNMNITITSYH 115 + V IN KG N ++H Sbjct: 59 HQVVINCAIPKGLKYNQATQTFH 81
>pdb|1EVH|A Chain A, Evh1 Domain From Murine Enabled In Complex With Acta Peptide Length = 112 Back     alignment and structure
>pdb|2IYB|A Chain A, Structure Of Complex Between The 3rd Lim Domain Of Tes And The Evh1 Domain Of Mena Length = 114 Back     alignment and structure
>pdb|1EGX|A Chain A, Solution Structure Of The Ena-Vasp Homology 1 (Evh1) Domain Of Human Vasodilator-Stimulated Phosphoprotein (Vasp) Length = 115 Back     alignment and structure
>pdb|1QC6|A Chain A, Evh1 Domain From EnaVASP-Like Protein In Complex With Acta Peptide Length = 130 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
1evh_A112 WH1 domain, protein (MENA EVH1 domain); molecular 9e-20
1xod_A118 Spred1; sprouty, EVH1, peptide-binding, signaling 1e-16
2jp2_A126 Spred-2, sprouty-related, EVH1 domain-containing p 2e-16
1egx_A115 VAsp, vasodilator-stimulated phosphoprotein; EVH1, 7e-16
3syx_A130 Sprouty-related, EVH1 domain-containing protein 1; 5e-15
1qc6_A130 EVH1 domain from ENA/VAsp-like protein; AN incompl 9e-15
1ddw_A120 GLGF-domain protein homer; pleckstrin homology dom 1e-14
1i2h_A168 PSD-ZIP45(homer-1C/VESL-1L); enabled VAsp homology 3e-12
1xke_A130 RAN-binding protein 2; beta barrel, pleckstrin-hom 4e-05
3n7c_A130 ABR034WP; nuclear pore complex, NUP2, RAN-binding 8e-05
2crf_A150 RAN binding protein 3; RAN_BP1 domain, ranbp3, str 1e-04
2y8g_A138 Ranbp3-B, RAN-binding protein 3; protein transport 4e-04
>1evh_A WH1 domain, protein (MENA EVH1 domain); molecular recognition, actin dynamics, contractIle protein; 1.80A {Mus musculus} SCOP: b.55.1.4 PDB: 2xqn_M 2iyb_A Length = 112 Back     alignment and structure
 Score = 76.9 bits (189), Expect = 9e-20
 Identities = 43/83 (51%), Positives = 55/83 (66%), Gaps = 6/83 (7%)

Query: 34  EQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADY 93
           EQSI  ARA+VM+YDD NKKW+P+G S+G S+VH++ H  NNTFRVVGRK+Q      D+
Sbjct: 3   EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQ------DH 56

Query: 94  TVSINIPNKKGSNMNITITSYHY 116
            V IN    KG   N    ++H 
Sbjct: 57  QVVINCAIPKGLKYNQATQTFHQ 79


>1xod_A Spred1; sprouty, EVH1, peptide-binding, signaling protein; 1.15A {Xenopus tropicalis} SCOP: b.55.1.4 PDB: 1tj6_A Length = 118 Back     alignment and structure
>2jp2_A Spred-2, sprouty-related, EVH1 domain-containing protein 2; solution structure, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1egx_A VAsp, vasodilator-stimulated phosphoprotein; EVH1, VAsp-ENA, poly-proline-binding domain, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.4 Length = 115 Back     alignment and structure
>3syx_A Sprouty-related, EVH1 domain-containing protein 1; WH1 domain, human sprouty-related, EVH1 domain-containing PR Q7Z699; 2.45A {Homo sapiens} Length = 130 Back     alignment and structure
>1qc6_A EVH1 domain from ENA/VAsp-like protein; AN incomplete seven stranded anti-parallel beta barrel closed by AN alpha helix, EVH1 domain; 2.60A {Mus musculus} SCOP: b.55.1.4 Length = 130 Back     alignment and structure
>1ddw_A GLGF-domain protein homer; pleckstrin homology domain fold, signaling protein; 1.70A {Rattus norvegicus} SCOP: b.55.1.4 PDB: 1ddv_A 2p8v_A 1i7a_A* Length = 120 Back     alignment and structure
>1i2h_A PSD-ZIP45(homer-1C/VESL-1L); enabled VAsp homology 1 domain, signaling protein; 1.80A {Rattus norvegicus} SCOP: b.55.1.4 Length = 168 Back     alignment and structure
>1xke_A RAN-binding protein 2; beta barrel, pleckstrin-homology (PH) domain, phosphotyrosine-binding (PTB) domain, protein transport; NMR {Homo sapiens} SCOP: b.55.1.3 Length = 130 Back     alignment and structure
>3n7c_A ABR034WP; nuclear pore complex, NUP2, RAN-binding domain, nucleoporin, structural genomics, PSI-2, protein structure initiative; 2.26A {Ashbya gossypii} PDB: 3oan_A Length = 130 Back     alignment and structure
>2crf_A RAN binding protein 3; RAN_BP1 domain, ranbp3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.3 Length = 150 Back     alignment and structure
>2y8g_A Ranbp3-B, RAN-binding protein 3; protein transport, CRM1-mediated nuclear export; 1.61A {Homo sapiens} PDB: 2y8f_A Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
3syx_A130 Sprouty-related, EVH1 domain-containing protein 1; 100.0
1evh_A112 WH1 domain, protein (MENA EVH1 domain); molecular 100.0
1egx_A115 VAsp, vasodilator-stimulated phosphoprotein; EVH1, 100.0
2jp2_A126 Spred-2, sprouty-related, EVH1 domain-containing p 100.0
1xod_A118 Spred1; sprouty, EVH1, peptide-binding, signaling 100.0
1ddw_A120 GLGF-domain protein homer; pleckstrin homology dom 100.0
1i2h_A168 PSD-ZIP45(homer-1C/VESL-1L); enabled VAsp homology 99.98
1qc6_A130 EVH1 domain from ENA/VAsp-like protein; AN incompl 99.96
2crf_A150 RAN binding protein 3; RAN_BP1 domain, ranbp3, str 99.19
1xke_A130 RAN-binding protein 2; beta barrel, pleckstrin-hom 99.08
2y8g_A138 Ranbp3-B, RAN-binding protein 3; protein transport 99.04
1rrp_B134 Nuclear pore complex protein NUP358; complex (smal 99.01
3n7c_A130 ABR034WP; nuclear pore complex, NUP2, RAN-binding 98.99
2ifs_A169 N-WAsp, wiskott-aldrich syndrome protien ineractin 98.84
1mke_A152 WIP - N-WAsp, fusion protein consisting of wiskott 98.75
1k5d_B201 RAN-specific GTPase-activating protein; ranbp1, ra 98.4
4hat_B140 RAN-specific GTPase-activating protein 1; heat rep 98.18
3m1i_B191 RAN-specific GTPase-activating protein 1; heat rep 98.03
2ec1_A125 Nucleoporin 50 kDa; ranbp domain, nuclear pore-ass 96.98
>3syx_A Sprouty-related, EVH1 domain-containing protein 1; WH1 domain, human sprouty-related, EVH1 domain-containing PR Q7Z699; 2.45A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.1e-37  Score=227.54  Aligned_cols=80  Identities=34%  Similarity=0.451  Sum_probs=74.9

Q ss_pred             ccceEEEEEEEEEEeCCCCCeEECCCCCCeEEEEEEEeC-----CCCceEEEEeeeccccccccceEEEeeecCCCCeee
Q psy9200          34 EQSIASARASVMIYDDVNKKWIPSGSSSGLSKVHVFQHQ-----VNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMN  108 (120)
Q Consensus        34 E~~I~~vrA~VM~yDd~tk~WvP~gg~~glS~V~i~~~~-----~~n~fRIvG~rlqD~~~~~~~~VvINc~I~~~l~Yn  108 (120)
                      .-+.|++||+||+|||+||+|||+|| +|+|.|+||+++     ++|+|||||+|++|+      +|+|||+|.++|+||
T Consensus        10 ~~~~~~~rA~Vm~~Dd~tk~WlP~gg-~glS~v~iy~~~~~~~~~~~~yRIvg~r~~d~------~vvinc~I~~~l~Yn   82 (130)
T 3syx_A           10 HMSYARVRAVVMTRDDSSGGWLPLGG-SGLSSVTVFKVPHQEENGCADFFIRGERLRDK------MVVLECMLKKDLIYN   82 (130)
T ss_dssp             TTEEEEEEEEEEEECSSSSCEEESSS-SCCEEEEEEEEESSSTTSSEEEEEEEEETTTC------CEEEEEECCTTCEEE
T ss_pred             cceeeEEEEEeeeEcCCCCceEeCCC-CCCceEEEEeccCCCCCCCcEEEEEEEecCCC------eEEEeeeecCCceEE
Confidence            44689999999999999999999998 899999999974     468999999999999      999999999999999


Q ss_pred             eecCcceeeccC
Q psy9200         109 ITITSYHYSKSK  120 (120)
Q Consensus       109 katptFHqWrD~  120 (120)
                      ||+|+||||||.
T Consensus        83 katp~FHqWrd~   94 (130)
T 3syx_A           83 KVTPTFHHWKID   94 (130)
T ss_dssp             EEETTEEEEEET
T ss_pred             eccccccccccc
Confidence            999999999985



>1evh_A WH1 domain, protein (MENA EVH1 domain); molecular recognition, actin dynamics, contractIle protein; 1.80A {Mus musculus} SCOP: b.55.1.4 PDB: 2xqn_M 2iyb_A Back     alignment and structure
>1egx_A VAsp, vasodilator-stimulated phosphoprotein; EVH1, VAsp-ENA, poly-proline-binding domain, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.4 Back     alignment and structure
>2jp2_A Spred-2, sprouty-related, EVH1 domain-containing protein 2; solution structure, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1xod_A Spred1; sprouty, EVH1, peptide-binding, signaling protein; 1.15A {Xenopus tropicalis} SCOP: b.55.1.4 PDB: 1tj6_A Back     alignment and structure
>1ddw_A GLGF-domain protein homer; pleckstrin homology domain fold, signaling protein; 1.70A {Rattus norvegicus} SCOP: b.55.1.4 PDB: 1ddv_A 2p8v_A 1i7a_A* Back     alignment and structure
>1i2h_A PSD-ZIP45(homer-1C/VESL-1L); enabled VAsp homology 1 domain, signaling protein; 1.80A {Rattus norvegicus} SCOP: b.55.1.4 Back     alignment and structure
>1qc6_A EVH1 domain from ENA/VAsp-like protein; AN incomplete seven stranded anti-parallel beta barrel closed by AN alpha helix, EVH1 domain; 2.60A {Mus musculus} SCOP: b.55.1.4 Back     alignment and structure
>2crf_A RAN binding protein 3; RAN_BP1 domain, ranbp3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.3 Back     alignment and structure
>1xke_A RAN-binding protein 2; beta barrel, pleckstrin-homology (PH) domain, phosphotyrosine-binding (PTB) domain, protein transport; NMR {Homo sapiens} SCOP: b.55.1.3 Back     alignment and structure
>2y8g_A Ranbp3-B, RAN-binding protein 3; protein transport, CRM1-mediated nuclear export; 1.61A {Homo sapiens} PDB: 2y8f_A Back     alignment and structure
>1rrp_B Nuclear pore complex protein NUP358; complex (small GTPase/nuclear protein), small GTPase, nuclear transport; HET: GNP; 2.96A {Homo sapiens} SCOP: b.55.1.3 Back     alignment and structure
>3n7c_A ABR034WP; nuclear pore complex, NUP2, RAN-binding domain, nucleoporin, structural genomics, PSI-2, protein structure initiative; 2.26A {Ashbya gossypii} PDB: 3oan_A Back     alignment and structure
>2ifs_A N-WAsp, wiskott-aldrich syndrome protien ineracting protein and neural wiskott-aldrich syndrome...; verprolin, polyproline, protein- protein complex; NMR {Homo sapiens} Back     alignment and structure
>1mke_A WIP - N-WAsp, fusion protein consisting of wiskott-aldrich syndrome protein interacting protein...; polyproline, protein-protein complex; NMR {Rattus norvegicus} SCOP: b.55.1.4 Back     alignment and structure
>1k5d_B RAN-specific GTPase-activating protein; ranbp1, rangap, GAP, signal transduction, nuclear transport, GTP hydrolysis, ground state; HET: GNP; 2.70A {Homo sapiens} SCOP: b.55.1.3 PDB: 1k5g_B* Back     alignment and structure
>4hat_B RAN-specific GTPase-activating protein 1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_B* 4hav_B* 4haw_B* 4hax_B* 4hay_B* 4haz_B* 4hb0_B* 4hb2_B* 4hb3_B* 4hb4_B* 4gmx_B* 4gpt_B* Back     alignment and structure
>3m1i_B RAN-specific GTPase-activating protein 1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ec1_A Nucleoporin 50 kDa; ranbp domain, nuclear pore-associated protein 60 kDa-like, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 120
d1i2ha_145 b.55.1.4 (A:) Homer {Rat (Rattus norvegicus) [TaxI 2e-16
d1xoda1114 b.55.1.4 (A:10-123) Sprouty-related, EVH1 domain-c 2e-16
d1evha_111 b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId 8e-16
d1egxa_115 b.55.1.4 (A:) Vasodilator-stimulated phosphoprotei 3e-12
d1xkea1118 b.55.1.3 (A:7-124) Ran-binding protein 2 {Human (H 1e-09
d2crfa1137 b.55.1.3 (A:8-144) Ran binding protein 3 {Human (H 2e-09
d1rrpb_134 b.55.1.3 (B:) Nuclear pore complex protein Nup358 5e-08
d1k5db_146 b.55.1.3 (B:) Ran-binding protein 1, Ranbp1 {Human 2e-05
>d1i2ha_ b.55.1.4 (A:) Homer {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Enabled/VASP homology 1 domain (EVH1 domain)
domain: Homer
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 68.4 bits (167), Expect = 2e-16
 Identities = 20/87 (22%), Positives = 27/87 (31%), Gaps = 11/87 (12%)

Query: 31  YATEQSIASARASVMIYDDVNKK-WIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEY 89
           +  EQ I S RA V   D   KK W+P  +S     V  F     N +R++         
Sbjct: 2   FMGEQPIFSTRAHVFQIDPNTKKNWVP--TSKHAVTVSYFYDSTRNVYRIISLD------ 53

Query: 90  KADYTVSINIPNKKGSNMNITITSYHY 116
                  IN           T   +  
Sbjct: 54  --GSKAIINSTITPNMTFTKTSQKFGQ 78


>d1xoda1 b.55.1.4 (A:10-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} Length = 114 Back     information, alignment and structure
>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1egxa_ b.55.1.4 (A:) Vasodilator-stimulated phosphoprotein (VASP) {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1xkea1 b.55.1.3 (A:7-124) Ran-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2crfa1 b.55.1.3 (A:8-144) Ran binding protein 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1rrpb_ b.55.1.3 (B:) Nuclear pore complex protein Nup358 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure
>d1k5db_ b.55.1.3 (B:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
d1i2ha_145 Homer {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1xoda1114 Sprouty-related, EVH1 domain-containing protein 1, 100.0
d1evha_111 Enabled {Mouse (Mus musculus) [TaxId: 10090]} 99.92
d1egxa_115 Vasodilator-stimulated phosphoprotein (VASP) {Huma 99.92
d1mkea1114 Actin regulatory protein WASP {Rat (Rattus norvegi 99.52
d1xkea1118 Ran-binding protein 2 {Human (Homo sapiens) [TaxId 98.96
d1rrpb_134 Nuclear pore complex protein Nup358 {Human (Homo s 98.95
d2crfa1137 Ran binding protein 3 {Human (Homo sapiens) [TaxId 98.91
d1k5db_146 Ran-binding protein 1, Ranbp1 {Human (Homo sapiens 98.6
>d1i2ha_ b.55.1.4 (A:) Homer {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Enabled/VASP homology 1 domain (EVH1 domain)
domain: Homer
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=1.8e-37  Score=231.85  Aligned_cols=80  Identities=24%  Similarity=0.352  Sum_probs=75.6

Q ss_pred             CccccceEEEEEEEEEEeCCCCC-eEECCCCCCeEEEEEEEeCCCCceEEEEeeeccccccccceEEEeeecCCCCeeee
Q psy9200          31 YATEQSIASARASVMIYDDVNKK-WIPSGSSSGLSKVHVFQHQVNNTFRVVGRKLQNQEYKADYTVSINIPNKKGSNMNI  109 (120)
Q Consensus        31 ~~~E~~I~~vrA~VM~yDd~tk~-WvP~gg~~glS~V~i~~~~~~n~fRIvG~rlqD~~~~~~~~VvINc~I~~~l~Ynk  109 (120)
                      +|+|+|||++||+||+|||++|+ |+|+|.  ++|+|+||+|+.+|+|||||+  +|+      +|+|||+|.+||+|||
T Consensus         2 ~m~E~~i~~~rA~V~~~d~~tkk~W~P~s~--~~s~V~i~~~~~~~~yRIvg~--~d~------~vvin~~i~~~l~y~k   71 (145)
T d1i2ha_           2 FMGEQPIFSTRAHVFQIDPNTKKNWVPTSK--HAVTVSYFYDSTRNVYRIISL--DGS------KAIINSTITPNMTFTK   71 (145)
T ss_dssp             CSSSCCSEEEEEEEEEECTTSSCCSEESCS--SCEEEEEEEETTTTEEEEEEE--ETT------EEEEEEECCTTCCEEE
T ss_pred             cccccceeEEEEEEEEECCCCCceeEECCC--CceEEEEEEcCCCceEEEEEe--cCC------eEEEEeeccCCceeee
Confidence            79999999999999999999986 999975  789999999999999999994  687      9999999999999999


Q ss_pred             ecCcceeeccC
Q psy9200         110 TITSYHYSKSK  120 (120)
Q Consensus       110 atptFHqWrD~  120 (120)
                      |+|+||||||.
T Consensus        72 as~~FhqWrd~   82 (145)
T d1i2ha_          72 TSQKFGQWADS   82 (145)
T ss_dssp             EETTEEEEEET
T ss_pred             cccceeEeeec
Confidence            99999999983



>d1xoda1 b.55.1.4 (A:10-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} Back     information, alignment and structure
>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egxa_ b.55.1.4 (A:) Vasodilator-stimulated phosphoprotein (VASP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkea1 b.55.1.4 (A:31-144) Actin regulatory protein WASP {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkea1 b.55.1.3 (A:7-124) Ran-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrpb_ b.55.1.3 (B:) Nuclear pore complex protein Nup358 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crfa1 b.55.1.3 (A:8-144) Ran binding protein 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k5db_ b.55.1.3 (B:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure