Diaphorina citri psyllid: psy9204


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MSFFFLYFTEGSSNFDHAWDGNYDITKISLALYSEGSSNFDHAWDGNYDITKISLALYSGLFAFGGWNYLNFVVDELQDPYNLVLPVTGQRLVRLEGVSIIVGCIIGSGIFVSPAGVLAETQSVGLSIVIWTVCGLLSTIGALCYAELGTCISRSGGDYAYILVAFGELPAFLRLWVALLIMRPTTQAIVALTFAQYAIKPFFPDSELPDRAVLLLAAACLCVLTAVNCMSVSWAMQVQTLFTVGKLVALFGIIAAGIGYLGIGL
ccEEEEEEccccccccccccccccccccHHHcccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcCEEEEcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
MSFFFLYFTEGSSNFDHAWDGNYDITKISLALYSEGSSNFDHAWDGNYDITKISLALYSGLFAFGGWNYLNFVVDELQDPYNLVLPVTGQRLVRLEGVSIIVGCIIGSGIFVSPAGVLAETQSVGLSIVIWTVCGLLSTIGALCYAELGTCISRSGGDYAYILVAFGELPAFLRLWVALLIMRPTTQAIVALTFAQYAIKPFFPDSELPDRAVLLLAAACLCVLTAVNCMSVSWAMQVQTLFTVGKLVALFGIIAAGIGYLGIGL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFFFLYFTEGSSNFDHAWDGNYDITKISLALYSEGSSNFDHAWDGNYDITKISLALYSGLFAFGGWNYLNFVVDELQDPYNLVLPVTGQRLVRLEGVSIIVGCIIGSGIFVSPAGVLAETQSVGLSIVIWTVCGLLSTIGALCYAELGTCISRSGGDYAYILVAFGELPAFLRLWVALLIMRPTTQAIVALTFAQYAIKPFFPDSELPDRAVLLLAAACLCVLTAVNCMSVSWAMQVQTLFTVGKLVALFGIIAAGIGYLGIGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Y+L amino acid transporter 2 Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires co-expression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Also acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Involved in the transport of L-arginine in monocytes. Reduces uptake of ornithine in retinal pigment epithelial (RPE) cells.confidentQ92536
Y+L amino acid transporter 2 Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires co-expression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Also acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis via transport of L-arginine. Involved in the transport of L-arginine in monocytes. Reduces uptake of ornithine in retinal pigment epithelial cells.confidentQ8BGK6
Y+L amino acid transporter 2 Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids.confidentQ28I80

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0003333 [BP]amino acid transmembrane transportprobableGO:0006810, GO:0006820, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0051179, GO:0071705, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699, GO:0046942
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0015179 [MF]L-amino acid transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015171, GO:0046943
GO:0015175 [MF]neutral amino acid transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015171, GO:0046943
GO:0015804 [BP]neutral amino acid transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015807 [BP]L-amino acid transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GIA, chain A
Confidence level:very confident
Coverage over the Query: 87-246
View the alignment between query and template
View the model in PyMOL
Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 52-82
View the alignment between query and template
View the model in PyMOL