Diaphorina citri psyllid: psy9205


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MSKEQGFQITLNLPRAIWIAMPIVTLVYVCANVAYFTVLTKEEMLTSPAVAVTFGGKIYKELVWIIPILVAMSTFGGVNGILFTSARLFLTGSQEGHLPPLFSYIHIKICLMSVLMLVTSDVFALINYMSVALWLSVGACTAGLISLRFTQPDLHRPIKVHLSLPIIFLACCIFLVVVPTIREPMNTVISLFIIASGVPVYYVCVKWKSKPALLLEMHEH
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHEEEEEEEEcccHHHHHHHHcc
MSKEQGFQITLNLPRAIWIAMPIVTLVYVCANVAYFTVLTKEEMLTSPAVAVTFGGKIYKELVWIIPILVAMSTFGGVNGILFTSARLFLTGSQEGHLPPLFSYIHIKICLMSVLMLVTSDVFALINYMSVALWLSVGACTAGLISLRFTQPDLHRPIKVHLSLPIIFLACCIFLVVVPTIREPMNTVISLFIIASGVPVYYVCVKWKSKPALLLEMHE*
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKEQGFQITLNLPRAIWIAMPIVTLVYVCANVAYFTVLTKEEMLTSPAVAVTFGGKIYKELVWIIPILVAMSTFGGVNGILFTSARLFLTGSQEGHLPPLFSYIHIKICLMSVLMLVTSDVFALINYMSVALWLSVGACTAGLISLRFTQPDLHRPIKVHLSLPIIFLACCIFLVVVPTIREPMNTVISLFIIASGVPVYYVCVKWKSKPALLLEMHEH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Large neutral amino acids transporter small subunit 2 Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney.confidentQ9QXW9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0015101 [MF]organic cation transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0008324, GO:0015075, GO:0022857, GO:0003674
GO:0019534 [MF]toxin transporter activityprobableGO:0005215, GO:0003674
GO:0003333 [BP]amino acid transmembrane transportprobableGO:0006810, GO:0006820, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0051179, GO:0071705, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699, GO:0046942
GO:0015179 [MF]L-amino acid transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015171, GO:0046943
GO:0015175 [MF]neutral amino acid transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015171, GO:0046943
GO:0015804 [BP]neutral amino acid transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015807 [BP]L-amino acid transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015695 [BP]organic cation transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 2-212
View the alignment between query and template
View the model in PyMOL