Diaphorina citri psyllid: psy9208

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440------

MNSTRGSKLLGWSAFTILVAAFTLLPTGQSQPSPPAVNCDYIDAEVNSYQPVVDRIIAAVSQGGHFQAHTYSTLADFVDKFGPRMTGSEALENSIDFMVKESKDFGLEVWTENVTAPKWERHFEKVTLVKPWKSDIPVSTLGGSVGTPQGGITAEVAGKIVVFNQDFVSYGETVKYRSKGASVASKYGAVATLIRSVTPYSLATPHTGHQSYDAAVKPIPTACIAPEYAEMLYRMYRRGDGPVVVSINIDARNVGTTNTRNTIVQIRGRECPDKVVITSGHLDSWDVGQGAMDDGGGAFISGILWTAEEQGYVGAIAYVKKHQEELKNITVAMESDDGTFTPFGLSLKGSPEAACILNKVLRLFKPINATRLVQSKYPVGSDIELFQEKNIPGVALLNDNAKYFWYHHTRADTMSVLDSDTLDLCTALWGGVAYILADLSVELPRT

cccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccCEEEEEEEccCEEEEEEEEEEcccccccccEEEccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccEEEccHHHHHHHHHHHHcccccEEEEEEEEEEECccCEEEEEEEEEccccccccEEEEEECcccccccccccccccccEEEEEEccccccccccHHHHHHHcHHHHHccEEEEEcccccccccccEECccHHHHHHHHHHHHHHccccccEECccccccccccHHHHHccccEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccc

********LLGWSAFTILVAAFTLLPT********AVNCDYIDAEVNSYQPVVDRIIAAVSQGGHFQAHTYSTLADFVDKFGPRMTGSEALENSIDFMVKESKDFGLEVWTENVTAPKWERHFEKVTLVKPWKSDIPVSTLGGSVGTPQGGITAEVAGKIVVFNQDFVSYGETVKYRSKGASVASKYGAVATLIRSVTPYSLATPHTGHQSYDAAVKPIPTACIAPEYAEMLYRMYRRGDGPVVVSINIDARNVGTTNTRNTIVQIRGRECPDKVVITSGHLDSWDVGQGAMDDGGGAFISGILWTAEEQGYVGAIAYVKKHQEELKNITVAMESDDGTFTPFGLSLKGSPEAACILNKVLRLFKPINATRLVQSKYPVGSDIELFQEKNIPGVALLNDNAKYFWYHHTRADTMSVLDSDTLDLCTALWGGVAYILADLSVELP**

xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Carboxypeptidase Q	Carboxypeptidase that may play an important role in the hydrolysis of circulating peptides. Catalyzes more efficiently the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in thyroxin hormone liberation from its TG/thyroglobulin precursor.	confident	Q9WVJ3
Carboxypeptidase Q	Carboxypeptidase that may play an important role in the hydrolysis of circulating peptides. Catalyzes more efficiently the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in thyroxin hormone liberation from its TG/thyroglobulin precursor.	confident	Q5RDN7
Carboxypeptidase Q	Carboxypeptidase that may play an important role in the hydrolysis of circulating peptides. Catalyzes more efficiently the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in thyroxin hormone liberation from its TG/thyroglobulin precursor.	confident	Q17QK3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006590 [BP]	thyroid hormone generation	probable	GO:0019752, GO:0006807, GO:0044281, GO:1901360, GO:0042445, GO:0044710, GO:0006520, GO:0071704, GO:0065007, GO:0065008, GO:0009987, GO:0006725, GO:0010817, GO:0008150, GO:0008152, GO:0043436, GO:0018958, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:0044237, GO:0042403, GO:1901615
GO:0043171 [BP]	peptide catabolic process	probable	GO:1901575, GO:1901564, GO:1901565, GO:0043603, GO:0009987, GO:0044237, GO:0044248, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006518, GO:0009056
GO:0070573 [MF]	metallodipeptidase activity	probable	GO:0016787, GO:0003824, GO:0016805, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237
GO:0006508 [BP]	proteolysis	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005764 [CC]	lysosome	probable	GO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IIB, chain A
Confidence level:very confident
Coverage over the Query: 52-446
View the alignment between query and template
View the model in PyMOL