Diaphorina citri psyllid: psy9209

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MRNKLYDKLNETEAAADLFMEFVSKLDTFAAPPDKTCGFFAFKYLANHHLKANNLDTAYKCAQKCLQHEETAEEAKSLLRSIAQKRQPDESSSQAVLYFQRALKLNPNYLGVWTLLGHEYMEMKNTNAAIQCYRQAIEINNLDYRAWYGLGQTYEILRLPYYGLYYYKQAHMVRPNDPRMLTALGEAFEKQEKISEAMKCYNKSRAIGDADGKALFKLAKLYDKLNETEAAADLFMEFVSKLDTFAAPPDKTCGFFAFKYLANHHLKANNLDTAYKCAQKCLQHEETAEEAKSLLRSIAQKRQPDESSSQPMECAVVLDPVPPSTRSSKFPANPAYPFATSDPDDDAFS
ccHHHHHHcccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccccccccc
MRNKLYDKLNETEAAADLFMEFVSKLDTFAAPPDKTCGFFAFKYLANHHLKANNLDTAYKCAQKCLQHEETAEEAKSLLRSIAQKRQPDESSSQAVLYFQRALKLNPNYLGVWTLLGHEYMEMKNTNAAIQCYRQAIEINNLDYRAWYGLGQTYEILRLPYYGLYYYKQAHMVRPNDPRMLTALGEAFEKQEKISEAMKCYNKSRAIGDADGKALFKLAKLYDKLNETEAAADLFMEFVSKLDTFAAPPDKTCGFFAFKYLANHHLKANNLDTAYKCAQKCLQHEETAEEAKSLLRSIAQKRQPDESSSQPMECAVVLDPVPPSTRSSKFPANPAYPF***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNKLYDKLNETEAAADLFMEFVSKLDTFAAPPDKTCGFFAFKYLANHHLKANNLDTAYKCAQKCLQHEETAEEAKSLLRSIAQKRQPDESSSQAVLYFQRALKLNPNYLGVWTLLGHEYMEMKNTNAAIQCYRQAIEINNLDYRAWYGLGQTYEILRLPYYGLYYYKQAHMVRPNDPRMLTALGEAFEKQEKISEAMKCYNKSRAIGDADGKALFKLAKLYDKLNETEAAADLFMEFVSKLDTFAAPPDKTCGFFAFKYLANHHLKANNLDTAYKCAQKCLQHEETAEEAKSLLRSIAQKRQPDESSSQPMECAVVLDPVPPSTRSSKFPANPAYPFATSDPDDDAFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cell division cycle protein 23 homolog Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.confidentQ8BGZ4
Cell division cycle protein 23 homolog Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.confidentA1A4R8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007080 [BP]mitotic metaphase plate congressionprobableGO:0022402, GO:0007067, GO:0051656, GO:0051303, GO:0044699, GO:0071840, GO:0000280, GO:0016043, GO:0007049, GO:0000278, GO:0009987, GO:0044763, GO:0051649, GO:0051310, GO:0007059, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0006996, GO:0000070, GO:0000819, GO:0051276, GO:0050000, GO:0048285, GO:0008150
GO:0030071 [BP]regulation of mitotic metaphase/anaphase transitionprobableGO:0007346, GO:0033043, GO:0008150, GO:0051726, GO:0010564, GO:0050794, GO:0051783, GO:1901987, GO:0065007, GO:1901990, GO:0051128, GO:0007088, GO:1902099, GO:0050789
GO:0000080 [BP]G1 phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0051318, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0005680 [CC]anaphase-promoting complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0000151, GO:0000152, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0031461, GO:0043227, GO:0043226, GO:0044422
GO:0070979 [BP]protein K11-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HYM, chain B
Confidence level:very confident
Coverage over the Query: 40-328
View the alignment between query and template
View the model in PyMOL
Template: 3HYM, chain B
Confidence level:very confident
Coverage over the Query: 2-304
View the alignment between query and template
View the model in PyMOL