Diaphorina citri psyllid: psy9223


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------
MSDLTLNLVHKFGIVQEYERAVIFRLGRVREGGPRGPGLFFILPCIDDYAKVDLRTVSFDVPPQEIVQEYERAVIFRLGRVREGGPRGPGLFFILPCIDDYAKVDLRTVSFDVPPQEVMSKDSVTLHVDAVVYYRRFLRKRLLAATTLRNVLGTRNLAEILSERESISHAMQANLDHATEPWGVKVERVEIKDVRLPQQLQRAMAAEAEATREGRAKVIAAEAEMKASRALKEAADVIVESPAALQLRYLQTLNSISQEKNSTIIFPIPVDIISTFMKNHSTRLLAATTLRNVLGTRNLAEILSERESISHAMQANLDHATEPWGVKVERVEIKDVRLPQQLQRAMAAEAEATREGRAKVIAAEAEMKASRALKEAADVIVESPAALQKRLQKIQTNYLFQLRYLQTLQSISQEKNSTIVFPIPLRYLQTLNSISQEKNSTIIFPIPVDIISTFMKK
ccccccccHHHcccccccHHHHEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccccccccccEEEEEccccccEEEEEEEEEECccccccccccccEEEEcEEEEEEEccHHHHHHHHHHHHHHcHHHHHHHHHcHHHHHHHHHHHHHHccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccEEEECcccccHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccHHHHHHHHHHHHHHHcccccEEEcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHcccccccccccccccccHHcccc
****TLNLVHKFGIVQEYERAVIFRLGRVREGGPRGPGLFFILPCIDDYAKVDLRTVSFDVPPQEIVQEYERAVIFRLGRVREGGPRGPGLFFILPCIDDYAKVDLRTVSFDVPPQEVMSKDSVTLHVDAVVYYRRFLRKRLLAATTLRNVLGTRNLAEILSERESISHAMQANLDHATEPWGVKVERVEIKDVRLPQQLQRAM*********GRAKVIAAEAEMKASRAL**AADVIVESPAALQLRYLQTLNSISQEKNSTIIFPIPVDIISTFMKNHSTRLLAATTLRNVLGTRNLAEILSERESISHAMQANLDHATEPWGVKVERVEIKDVRLPQQLQRAM***********AKVIAAEAEMKA*******ADVIVESPAALQKRLQKIQTNYLFQLRYLQTLQSISQEKNSTIVFPIPLRYLQTLNSISQ*****II*****DIISTFM**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDLTLNLVHKFGIVQEYERAVIFRLGRVREGGPRGPGLFFILPCIDDYAKVDLRTVSFDVPPQEIVQEYERAVIFRLGRVREGGPRGPGLFFILPCIDDYAKVDLRTVSFDVPPQEVMSKDSVTLHVDAVVYYRRFLRKRLLAATTLRNVLGTRNLAEILSERESISHAMQANLDHATEPWGVKVERVEIKDVRLPQQLQRAMAAEAEATREGRAKVIAAEAEMKASRALKEAADVIVESPAALQLRYLQTLNSISQEKNSTIIFPIPVDIISTFMKNHSTRLLAATTLRNVLGTRNLAEILSERESISHAMQANLDHATEPWGVKVERVEIKDVRLPQQLQRAMAAEAEATREGRAKVIAAEAEMKASRALKEAADVIVESPAALQKRLQKIQTNYLFQLRYLQTLQSISQEKNSTIVFPIPLRYLQTLNSISQEKNSTIIFPIPVDIISTFMKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Erythrocyte band 7 integral membrane protein Thought to regulate cation conductance. May regulate ASIC2 and ASIC3 gating.confidentP27105
Erythrocyte band 7 integral membrane protein Thought to regulate cation conductance. May regulate ASIC2 and ASIC3 gating.confidentP54116
Uncharacterized protein AF_1420 confidentO28852

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0070062 [CC]extracellular vesicular exosomeprobableGO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0032589 [CC]neuron projection membraneprobableGO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0005575, GO:0097458, GO:0071944, GO:0043005, GO:0044425, GO:0044464, GO:0005886, GO:0042995, GO:0044459
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FVG, chain A
Confidence level:very confident
Coverage over the Query: 104-199
View the alignment between query and template
View the model in PyMOL
Template: 3BK6, chain A
Confidence level:very confident
Coverage over the Query: 97-252
View the alignment between query and template
View the model in PyMOL
Template: 3BK6, chain A
Confidence level:very confident
Coverage over the Query: 280-387,401-407
View the alignment between query and template
View the model in PyMOL
Template: 2ZUO, chain A
Confidence level:probable
Coverage over the Query: 65-234
View the alignment between query and template
View the model in PyMOL