Diaphorina citri psyllid: psy9235

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MQAQQNSFMKENAQLFEANATIKLEEEEPESSCMDVVEHPVALGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSIQTTTPTENAEVFVHMDFDAWLSIVEMVLEHKKRLKKSKATSECQDSTSSKQVPQDRKPLEINRLINLPDDYSELINTVSLFTCPNSDREDSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH
cHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccCECcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHcccccccccHHHHHHHHHccccccccccccccccHHHHHcccccccccccccccccccccHHHHHHHHHccccc
****QNSF***N******************************LGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNR***RTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALS***********EVFVHMDFDAWLSIVEMVLEHKKR*******************PQDRKPLEINRLINLPDDYSELINTVSLFTCP*****DSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAQQNSFMKENAQLFEANATIKLEEEEPESSCMDVVEHPVALGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSIQTTTPTENAEVFVHMDFDAWLSIVEMVLEHKKRLKKSKATSECQDSTSSKQVPQDRKPLEINRLINLPDDYSELINTVSLFTCPNSDREDSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NW0, chain A
Confidence level:probable
Coverage over the Query: 114-136,158-176
View the alignment between query and template
View the model in PyMOL
Template: 3J20, chain W
Confidence level:probable
Coverage over the Query: 245-289
View the alignment between query and template
View the model in PyMOL