Psyllid ID: psy9235

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MQAQQNSFMKENAQLFEANATIKLEEEEPESSCMDVVEHPVALGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSIQTTTPTENAEVFVHMDFDAWLSIVEMVLEHKKRLKKSKATSECQDSTSSKQVPQDRKPLEINRLINLPDDYSELINTVSLFTCPNSDREDSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH
cHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHcccccccccccccccHHHHHcccccccccccccccccccccHHHHHHHHHccccc
cHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEcccccccccccccccEEEEEEEcccccccccccEEEEEEEEccEEEEccccccccccccccccccHHHcccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHcccEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccEEEEEEcHEEccccccccHHHccccccEEEEEEccEEEEcc
MQAQQNSFMKENAQLFEANAtikleeeepesscmdvvehpvalgpnqtprpntgpvyYTCILCQEEQALTKQNDALVLAAFVQQSTVMfrnrnadrtdfkVNSLYISLehqgpaphtstcghvmhstcwsKYFDNIlakenrrpyrlrqptsfdiekneflcplceclsnaalplipalssiqtttptenaevFVHMDFDAWLSIVEMVLEHKKRLKkskatsecqdstsskqvpqdrkpleinrlinlpddyseLINTvslftcpnsdredsrnpalclicgdmlcsqsyccQTELFFKMSARSFFTVNKTLFLVH
mqaqqnsfmkenaQLFEANATIKLEEEEPESSCMDVVEHPValgpnqtprpnTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTvmfrnrnadrtDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSIQTTTPTENAEVFVHMDFDAWLSIVEMVLEHKKRLKkskatsecqdstsskqvpqdrkplEINRLINLPDDYSELINTVSLFTCPNSDREDSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH
MQAQQNSFMKENAQLFEANATIKLEEEEPESSCMDVVEHPVALGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSIQTTTPTENAEVFVHMDFDAWLSIVEMVLEHKKRLKKSKATSECQDSTSSKQVPQDRKPLEINRLINLPDDYSELINTVSLFTCPNSDREDSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH
*****************************************************GPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSIQTTTPTENAEVFVHMDFDAWLSIVEMVLE*******************************INRLINLPDDYSELINTVSLFTCP********NPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLV*
****QNSF***N******************************LGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTV********************LEHQGPAPHTSTCGHVMHSTCWSKYFDN****************SFDIEKNEFLCPLCECLSNAALPLIPAL*****************MDFDAWLSIVEMVLEHKKRLKKSKATSECQDSTSSKQVPQDRKPLEINRLINLPDDYSELINTVS**********DSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH
MQAQQNSFMKENAQLFEANATIKL**********DVVEHPVALGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSIQTTTPTENAEVFVHMDFDAWLSIVEMVLEH*************************RKPLEINRLINLPDDYSELINTVSLFTCPNSDREDSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH
****************E*N********************PVAL*P*QTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNR***RTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALS***********EVFVHMDFDAWLSIVEMVLEHKKR*******************PQDRKPLEINRLINLPDDYSELINTVSLFTCPNSDREDSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAQQNSFMKENAQLFEANATIKLEEEEPESSCMDVVEHPVALGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSIQTTTPTENAEVFVHMDFDAWLSIVEMVLEHKKRLKKSKATSECQDSTSSKQVPQDRKPLEINRLINLPDDYSELINTVSLFTCPNSDREDSRNPALCLICGDMLCSQSYCCQTELFFKMSARSFFTVNKTLFLVH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query317 2.2.26 [Sep-21-2011]
Q8IWV8 1755 E3 ubiquitin-protein liga yes N/A 0.839 0.151 0.346 3e-35
Q6WKZ8 1755 E3 ubiquitin-protein liga yes N/A 0.526 0.095 0.448 3e-34
O70481 1757 E3 ubiquitin-protein liga no N/A 0.615 0.110 0.327 1e-23
Q8IWV7 1749 E3 ubiquitin-protein liga no N/A 0.539 0.097 0.335 7e-22
Q9VX91 1824 E3 ubiquitin-protein liga yes N/A 0.520 0.090 0.345 1e-18
P91133 2058 E3 ubiquitin-protein liga yes N/A 0.640 0.098 0.308 3e-16
O60152 1958 E3 ubiquitin-protein liga yes N/A 0.492 0.079 0.266 0.0002
Q5U430 1889 E3 ubiquitin-protein liga no N/A 0.208 0.034 0.32 0.0004
Q6ZT12 1888 E3 ubiquitin-protein liga no N/A 0.208 0.034 0.32 0.0004
>sp|Q8IWV8|UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens GN=UBR2 PE=1 SV=1 Back     alignment and function desciption
 Score =  149 bits (376), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/297 (34%), Positives = 157/297 (52%), Gaps = 31/297 (10%)

Query: 1    MQAQQNSFMKENAQLFEAN-----ATIKLEEEEPESSCMDVVEHPVALGPNQTPRPNTGP 55
            M   Q  F+ EN +LF+       +T  + +  P +S M +     ALGP QT  P    
Sbjct: 1049 MSEMQRHFIDENKELFQQTLELDASTSAVLDHSPVASDMTLT----ALGPAQTQVPEQRQ 1104

Query: 56   VYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTD-FKVNSLYISLEHQGPA 114
             + TCILCQEEQ +  ++ A+VLAAFVQ+STV+ +NR+    D  K + L++  +     
Sbjct: 1105 -FVTCILCQEEQEVKVESRAMVLAAFVQRSTVLSKNRSKFIQDPEKYDPLFMHPD-LSCG 1162

Query: 115  PHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALP 174
             HTS+CGH+MH+ CW +YFD++ AKE RR  RLR  TS+D+E  EFLCPLCECLSN  +P
Sbjct: 1163 THTSSCGHIMHAHCWQRYFDSVQAKEQRRQQRLRLHTSYDVENGEFLCPLCECLSNTVIP 1222

Query: 175  LIPALSSIQTTTPTENAEVFVHMDFDAWLSIVEMVLEHKKRLKKSKATSECQDSTSSK-- 232
            L+    +I       + +     +   W+  +   ++  + L+K ++T     + +S+  
Sbjct: 1223 LLLPPRNIFNNRLNFSDQP----NLTQWIRTISQQIKALQFLRKEESTPNNASTKNSENV 1278

Query: 233  ---QVPQDRKPLEINRLINLPDDYSELINT-------VSLFTCPNSDREDSRNPALC 279
               Q+P+  +P +    I   +   E++ T       V L   PN   ED R P +C
Sbjct: 1279 DELQLPEGFRP-DFRPKIPYSESIKEMLTTFGTATYKVGLKVHPNE--EDPRVPIMC 1332
E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Plays a critical role in chromatin inactivation and chromosome-wide transcriptional silencing during meiosis via ubiquitination of histone H2A. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q6WKZ8|UBR2_MOUSE E3 ubiquitin-protein ligase UBR2 OS=Mus musculus GN=Ubr2 PE=1 SV=2 Back     alignment and function description
>sp|O70481|UBR1_MOUSE E3 ubiquitin-protein ligase UBR1 OS=Mus musculus GN=Ubr1 PE=1 SV=2 Back     alignment and function description
>sp|Q8IWV7|UBR1_HUMAN E3 ubiquitin-protein ligase UBR1 OS=Homo sapiens GN=UBR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9VX91|UBR1_DROME E3 ubiquitin-protein ligase UBR1 OS=Drosophila melanogaster GN=UBR1 PE=2 SV=2 Back     alignment and function description
>sp|P91133|UBR1_CAEEL E3 ubiquitin-protein ligase ubr-1 OS=Caenorhabditis elegans GN=ubr-1 PE=1 SV=2 Back     alignment and function description
>sp|O60152|UBR1_SCHPO E3 ubiquitin-protein ligase ubr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubr1 PE=3 SV=1 Back     alignment and function description
>sp|Q5U430|UBR3_MOUSE E3 ubiquitin-protein ligase UBR3 OS=Mus musculus GN=Ubr3 PE=1 SV=3 Back     alignment and function description
>sp|Q6ZT12|UBR3_HUMAN E3 ubiquitin-protein ligase UBR3 OS=Homo sapiens GN=UBR3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
383852864 1781 PREDICTED: E3 ubiquitin-protein ligase U 0.694 0.123 0.491 5e-52
91080927 1757 PREDICTED: similar to ubiquitin ligase E 0.678 0.122 0.48 9e-52
380014703 1779 PREDICTED: E3 ubiquitin-protein ligase U 0.675 0.120 0.478 3e-50
66504949 1779 PREDICTED: e3 ubiquitin-protein ligase U 0.675 0.120 0.478 5e-50
350415865 1770 PREDICTED: E3 ubiquitin-protein ligase U 0.630 0.112 0.490 8e-49
340710330 1770 PREDICTED: e3 ubiquitin-protein ligase U 0.842 0.150 0.401 1e-48
307195539 1786 E3 ubiquitin-protein ligase UBR2 [Harpeg 0.681 0.120 0.476 2e-48
345480861 1815 PREDICTED: E3 ubiquitin-protein ligase U 0.681 0.119 0.452 6e-48
242009898 1786 ubiquitin-protein ligase E3 component N- 0.659 0.117 0.486 5e-46
193638845 1814 PREDICTED: e3 ubiquitin-protein ligase U 0.700 0.122 0.44 2e-45
>gi|383852864|ref|XP_003701945.1| PREDICTED: E3 ubiquitin-protein ligase UBR2-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  211 bits (536), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 149/232 (64%), Gaps = 12/232 (5%)

Query: 1    MQAQQNSFMKENAQLFEANATIKLEEEEPESSCMDVVE----HPVALGPNQTPRPNTGPV 56
            M A Q +FMKENA+LFE  A + + +     S M++ E     PVA+G  QT R +    
Sbjct: 1038 MAAMQKNFMKENAELFE-EAALDVNKSNDRDSSMNLSECSQKTPVAVGIGQTSRMSEEET 1096

Query: 57   YYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPH 116
            Y TCILCQE Q +T    A+VLAAFVQQSTV+ +NR +     +   LY+S    G +PH
Sbjct: 1097 YKTCILCQENQIVTATGPAMVLAAFVQQSTVLCQNRASLMNIEESTPLYLS-SKLGASPH 1155

Query: 117  TSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLI 176
            TSTCGHVMH  CW KYF+N+LAKENRRP+RLRQP  FD+EK+E+LCPLCECLSN  LPL+
Sbjct: 1156 TSTCGHVMHVHCWQKYFNNVLAKENRRPFRLRQPAGFDVEKHEYLCPLCECLSNTVLPLL 1215

Query: 177  PALSSIQTTTPTENAEVFVHMDFDAWLSIVEMV-LEHKKRLKKSKATSECQD 227
            PAL ++Q  TP    E    +DF  WL  +++       +L K++++ E  D
Sbjct: 1216 PALGTLQ-PTPQNQPE----LDFGTWLEALKITECNPSGKLYKAQSSKENND 1262

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91080927|ref|XP_974039.1| PREDICTED: similar to ubiquitin ligase E3 alpha [Tribolium castaneum] gi|270005384|gb|EFA01832.1| hypothetical protein TcasGA2_TC007434 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380014703|ref|XP_003691360.1| PREDICTED: E3 ubiquitin-protein ligase UBR2-like [Apis florea] Back     alignment and taxonomy information
>gi|66504949|ref|XP_394362.2| PREDICTED: e3 ubiquitin-protein ligase UBR2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350415865|ref|XP_003490772.1| PREDICTED: E3 ubiquitin-protein ligase UBR2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340710330|ref|XP_003393745.1| PREDICTED: e3 ubiquitin-protein ligase UBR2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307195539|gb|EFN77425.1| E3 ubiquitin-protein ligase UBR2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345480861|ref|XP_001606200.2| PREDICTED: E3 ubiquitin-protein ligase UBR2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242009898|ref|XP_002425719.1| ubiquitin-protein ligase E3 component N-recognin-2, putative [Pediculus humanus corporis] gi|212509620|gb|EEB12981.1| ubiquitin-protein ligase E3 component N-recognin-2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|193638845|ref|XP_001952747.1| PREDICTED: e3 ubiquitin-protein ligase UBR1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
UNIPROTKB|F1P5I1 1737 UBR1 "Uncharacterized protein" 0.624 0.113 0.339 1.1e-38
MGI|MGI:1277977 1757 Ubr1 "ubiquitin protein ligase 0.615 0.110 0.336 3.1e-38
UNIPROTKB|E2QV58 1750 UBR1 "Uncharacterized protein" 0.621 0.112 0.325 3.9e-38
UNIPROTKB|F6X9P0 1753 UBR1 "Uncharacterized protein" 0.621 0.112 0.325 3.9e-38
UNIPROTKB|J9P162 1753 UBR1 "Uncharacterized protein" 0.621 0.112 0.325 3.9e-38
UNIPROTKB|E1BIW0 1742 UBR1 "Uncharacterized protein" 0.621 0.113 0.316 5e-38
UNIPROTKB|F1SI45 1640 UBR1 "Uncharacterized protein" 0.621 0.120 0.316 5.4e-38
UNIPROTKB|I3LQA5 1648 UBR1 "Uncharacterized protein" 0.621 0.119 0.316 5.5e-38
RGD|1562326 1757 Ubr1 "ubiquitin protein ligase 0.615 0.110 0.336 2.8e-37
UNIPROTKB|Q8IWV7 1749 UBR1 "E3 ubiquitin-protein lig 0.621 0.112 0.316 4.5e-37
UNIPROTKB|F1P5I1 UBR1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 1.1e-38, Sum P(2) = 1.1e-38
 Identities = 72/212 (33%), Positives = 117/212 (55%)

Query:     1 MQAQQNSFMKENAQLFEANATIKLEEEE--PESSCMDVVEHP-VALGPNQTPRPNTGPVY 57
             M A Q +F++ +  L+E     + +E+    E S    +++  +ALGP + P      V 
Sbjct:  1018 MSALQRNFIETHKLLYENTLEAQGKEDAIMEEESLSSAIDYSRIALGPKRGPSIAEKEVL 1077

Query:    58 YTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNA--DRTDFKVNSLYISLEHQGPAP 115
              TCILCQEEQ +  ++ A+VL+A VQ+ST + +NR+   + +   V+ L++  +      
Sbjct:  1078 -TCILCQEEQEVKLESAAMVLSACVQKSTALTQNRSRILELSGDTVDPLFMHPDLPC-GT 1135

Query:   116 HTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPL 175
             HT +CGHVMH+ CW KYF+ +  + N R  RL     FD+E  E+LCPLC+ L N  +P+
Sbjct:  1136 HTGSCGHVMHAACWQKYFEAM--QLNFRQ-RLHVEQIFDLENGEYLCPLCKSLCNTVIPI 1192

Query:   176 IPALSSIQTTTPTENAEVFVH-MDFDAWLSIV 206
             +P L + +  +  E+AE     +    WL  +
Sbjct:  1193 VP-LQAQKINS--EDAEAVAQILSLARWLETI 1221
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000151 "ubiquitin ligase complex" evidence=IEA
GO:0000502 "proteasome complex" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0032007 "negative regulation of TOR signaling cascade" evidence=IEA
GO:0070728 "leucine binding" evidence=IEA
GO:0071233 "cellular response to leucine" evidence=IEA
MGI|MGI:1277977 Ubr1 "ubiquitin protein ligase E3 component n-recognin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV58 UBR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6X9P0 UBR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P162 UBR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BIW0 UBR1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SI45 UBR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQA5 UBR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1562326 Ubr1 "ubiquitin protein ligase E3 component n-recognin 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IWV7 UBR1 "E3 ubiquitin-protein ligase UBR1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 317
KOG1140|consensus 1738 99.87
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.01
KOG1139|consensus784 96.92
KOG1139|consensus784 96.69
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.2
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.88
KOG1940|consensus276 95.19
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 94.88
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 94.85
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 94.81
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 94.58
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 94.47
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 93.77
PF1463444 zf-RING_5: zinc-RING finger domain 93.55
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 92.76
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 92.42
PF1324023 zinc_ribbon_2: zinc-ribbon domain 92.36
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 92.3
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 91.9
PHA02929238 N1R/p28-like protein; Provisional 91.78
PHA02926242 zinc finger-like protein; Provisional 90.37
KOG4445|consensus368 90.28
PF1324826 zf-ribbon_3: zinc-ribbon domain 89.67
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 88.45
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 88.38
PF0166755 Ribosomal_S27e: Ribosomal protein S27; InterPro: I 87.64
PF13764802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 87.59
COG205167 RPS27A Ribosomal protein S27E [Translation, riboso 87.45
PTZ0008385 40S ribosomal protein S27; Provisional 85.57
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 85.3
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 84.89
KOG2930|consensus114 81.84
PLN0020986 ribosomal protein S27; Provisional 81.27
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 80.06
>KOG1140|consensus Back     alignment and domain information 
Probab=99.87  E-value=1.3e-22  Score=223.49  Aligned_cols=159  Identities=28%  Similarity=0.429  Sum_probs=110.0

Q ss_pred             CHHHHHHHHHHhHHhhhhhhcccccccCCcCccCCCCCC-------ccccCCCCCCCCCCCCCccceeecCCCccccc-C
Q psy9235           1 MQAQQNSFMKENAQLFEANATIKLEEEEPESSCMDVVEH-------PVALGPNQTPRPNTGPVYYTCILCQEEQALTK-Q   72 (317)
Q Consensus         1 ms~~Qk~Fm~~N~~l~~~~~~~~~e~~~~~~~~md~~~~-------~valGp~~~~~~~~~~~~~tCILCqE~~~~~~-~   72 (317)
                      |++||.+||++|.+-|++.. +..++..+ ......+..       .-.+-+..+..........+|++|++...+.. .
T Consensus      1039 ~s~qq~kfm~~~e~e~d~~~-~~~~~~~~-~~~~~~d~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~i~~e~e~~~~~~ 1116 (1738)
T KOG1140|consen 1039 FSNQQTKFMAENEDEFDEQE-NQTPSSGS-KTYEEEDFTCALCQDNSCTDFQVKPASHLVKPIFRECIICDENEDVPNWD 1116 (1738)
T ss_pred             HHHHHHHHHHhcccccCccc-ccCccccc-cchhhhhccchhhhccchhccccccchhhhcccccccccCChhccCCCcc
Confidence            68999999999976665521 11111111 000000000       00001111222212345679999999998865 5


Q ss_pred             CCcEEEEEeeecCcccccccCCCCCCCcccccccCCCCCCCCceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCc
Q psy9235          73 NDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTS  152 (317)
Q Consensus        73 ~~p~g~~a~vQ~S~Vl~~~~~~~~~~~~D~~l~~~~~~~~~g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~  152 (317)
                      +..++..+|+|+++....            +++.+. ....|+++++|||.||+.||++|+++.+.+++.+....+.+..
T Consensus      1117 ~~~~v~~~f~~~s~~~sd------------~l~~p~-~~~~~~~~s~c~h~mh~~c~~~~~~a~r~~~n~~~~~l~~~~s 1183 (1738)
T KOG1140|consen 1117 GRYSVSSAFAQKSDDVSD------------ALTEPG-SLSCGTVLSSCGHHMHYGCFKRYVQAKRFRENARTAPLCQHYS 1183 (1738)
T ss_pred             ccchhhhHhhhhcccccc------------cccCCC-CCcccceeeccCCcchHHHHHHHHHHHHHHHHhhhcCcccccc
Confidence            689999999999987751            344454 6778999999999999999999999999888887776666544


Q ss_pred             cCCCCCeeeccCCccccceEeccCC
Q psy9235         153 FDIEKNEFLCPLCECLSNAALPLIP  177 (317)
Q Consensus       153 ~d~~~~EFlCPLCrsLsN~vLP~ip  177 (317)
                         ++++|+||+|++|+|+.||.++
T Consensus      1184 ---e~~l~lCp~c~slsn~~lp~~~ 1205 (1738)
T KOG1140|consen 1184 ---ENGLFLCPLCKSLSNVSLPMFL 1205 (1738)
T ss_pred             ---cCCcccCCchHhhhhccCCcCC
Confidence               7899999999999999999654

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG1139|consensus Back     alignment and domain information
>KOG1139|consensus Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information
>PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00083 40S ribosomal protein S27; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>PLN00209 ribosomal protein S27; Provisional Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.84
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 96.3
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 96.1
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 96.02
2ecm_A55 Ring finger and CHY zinc finger domain- containing 95.96
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 95.85
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 95.84
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 95.84
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 95.73
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 95.67
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 95.58
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 95.5
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 95.43
2ecw_A85 Tripartite motif-containing protein 30; metal bind 95.32
2ysl_A73 Tripartite motif-containing protein 31; ring-type 95.26
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 95.05
2ect_A78 Ring finger protein 126; metal binding protein, st 94.82
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 94.8
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 94.73
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 94.64
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 94.44
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 94.41
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 94.23
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 94.15
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 94.06
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 94.04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 93.97
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 93.89
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 93.87
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 93.84
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 93.67
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 93.5
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 93.3
2ysj_A63 Tripartite motif-containing protein 31; ring-type 93.21
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 93.06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 93.02
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 92.96
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 92.82
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 92.09
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 92.0
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 91.61
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 91.32
1z6u_A150 NP95-like ring finger protein isoform B; structura 91.26
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 91.15
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 90.94
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 90.94
3j20_W63 30S ribosomal protein S27E; archaea, archaeal, KIN 90.74
3nw0_A238 Non-structural maintenance of chromosomes element 90.43
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 89.52
1qxf_A66 GR2, 30S ribosomal protein S27E; structural genomi 88.86
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 83.94
2ea5_A68 Cell growth regulator with ring finger domain prot 83.47
2xzm_681 RPS27E; ribosome, translation; 3.93A {Tetrahymena 83.35
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 83.14
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 82.7
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 82.05
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 81.49
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 81.44
3u5c_b82 RP61, YS20, 40S ribosomal protein S27-A; translati 80.43
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=96.84  E-value=0.00041  Score=52.75  Aligned_cols=39  Identities=36%  Similarity=0.647  Sum_probs=29.9

Q ss_pred             cCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccccceEeccCCC
Q psy9235         119 TCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPA  178 (317)
Q Consensus       119 sCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLsN~vLP~ip~  178 (317)
                      .|||.+|..|+.+|+++.            .         .=.||+|++.-..-+|-+|+
T Consensus        33 ~C~h~fH~~Ci~kWl~~~------------~---------~~~CP~Cr~~w~~~~~~~~~   71 (74)
T 2ct0_A           33 TCGIRMHLPCVAKYFQSN------------A---------EPRCPHCNDYWPHEIPKSGP   71 (74)
T ss_dssp             SSCCEECHHHHHHHSTTC------------S---------SCCCTTTCSCCCSCCCCCCS
T ss_pred             CCCchhhHHHHHHHHHhc------------C---------CCCCCCCcCcCCCCCCCCCC
Confidence            899999999999998432            1         11799999887766666554
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.05
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 96.61
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 96.32
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.06
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 96.0
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.87
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 95.36
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 94.93
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 94.55
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 93.56
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 92.9
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 90.6
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 88.65
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 88.06
d1qxfa_58 Ribosomal protein S27e {Archaeon Archaeoglobus ful 87.93
d2c2la280 STIP1 homology and U box-containing protein 1, STU 80.01
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Deltex protein 2 RING-H2 domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.05  E-value=0.00011  Score=57.32  Aligned_cols=38  Identities=21%  Similarity=0.533  Sum_probs=28.3

Q ss_pred             CceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCcccc
Q psy9235         114 APHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLS  169 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLs  169 (317)
                      -+.+..|||..|..|+.++++...                  ..+.+.||+||+.-
T Consensus        55 ~~~~~~CgH~FH~~Ci~~Wl~~~~------------------~~~~~~CP~CR~~~   92 (114)
T d1v87a_          55 VGRLTKCSHAFHLLCLLAMYCNGN------------------KDGSLQCPSCKTIY   92 (114)
T ss_dssp             CEEESSSCCEECHHHHHHHHHHTC------------------CSSCCBCTTTCCBS
T ss_pred             ceEECCCCChhhHHHHHHHHHhcC------------------cCCCCccccccchh
Confidence            345678999999999999985421                  12356899999754
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure