Diaphorina citri psyllid: psy9245


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MIKSNQSHSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTKQRKDQVLFI
ccccccccccEEcccccccHHHHcccccccccccHHHHHHcccEEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHcccccccccc
******SHSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTKQR*D*VLFI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKSNQSHSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPLxxxxxxxxxxxxxxxxxxxxxTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTKQRKDQVLFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenylate kinase 2, mitochondrial Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth.confidentQ9U915
Adenylate kinase 2, mitochondrial Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth. Plays a key role in hematopoiesis.confidentP54819
Adenylate kinase 2, mitochondrial Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth. Plays a key role in hematopoiesis.confidentQ28F55

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032559 [MF]adenyl ribonucleotide bindingprobableGO:0030554, GO:0097159, GO:0000166, GO:0036094, GO:0003674, GO:0032553, GO:0032555, GO:0017076, GO:1901363, GO:1901265, GO:0005488
GO:0032550 [MF]purine ribonucleoside bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:0032549, GO:1901363, GO:0001883, GO:0001882
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0046034 [BP]ATP metabolic processprobableGO:0009141, GO:0009144, GO:0034641, GO:0006807, GO:0044237, GO:0072521, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0071704, GO:0009199, GO:0009205, GO:0009987, GO:0006725, GO:0009150, GO:0009117, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0046033 [BP]AMP metabolic processprobableGO:0009167, GO:0034641, GO:0006807, GO:0044237, GO:0009161, GO:0009123, GO:0009126, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0071704, GO:0009987, GO:0006725, GO:0009150, GO:0072521, GO:0009117, GO:0009116, GO:0008152, GO:0009119, GO:0046128, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0046060 [BP]dATP metabolic processprobableGO:0009215, GO:0009141, GO:0009144, GO:0006139, GO:0034641, GO:0006807, GO:0044281, GO:0072521, GO:1901360, GO:0009394, GO:0044710, GO:0071704, GO:0009200, GO:0009987, GO:0006725, GO:0009151, GO:0009262, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:0019692, GO:0006163, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0009218 [BP]pyrimidine ribonucleotide metabolic processprobableGO:0034641, GO:0006807, GO:0044237, GO:0009259, GO:1901360, GO:0072527, GO:0006220, GO:0006139, GO:0044710, GO:0071704, GO:0009987, GO:0006725, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0019693, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0046131 [BP]pyrimidine ribonucleoside metabolic processprobableGO:0034641, GO:0006807, GO:0006213, GO:1901360, GO:0072527, GO:0006139, GO:0044710, GO:0071704, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0009119, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:1901657, GO:0044281
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0006172 [BP]ADP biosynthetic processprobableGO:0009185, GO:0009180, GO:0044237, GO:0009188, GO:0044249, GO:0034641, GO:0009165, GO:0009163, GO:0072521, GO:0072522, GO:0009133, GO:0009259, GO:1901360, GO:1901362, GO:0006139, GO:0044710, GO:0009132, GO:0090407, GO:0009179, GO:0042278, GO:0008150, GO:0071704, GO:0055086, GO:0046483, GO:0044281, GO:0018130, GO:0009987, GO:1901576, GO:0006725, GO:0006793, GO:0046031, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0009116, GO:0008152, GO:0034654, GO:1901564, GO:0009119, GO:0046128, GO:0009135, GO:0042455, GO:0009136, GO:0046129, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0006807, GO:0042451, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:1901659
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0004017 [MF]adenylate kinase activityprobableGO:0019201, GO:0019205, GO:0016772, GO:0016301, GO:0016776, GO:0003824, GO:0016740, GO:0003674
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0097226 [CC]sperm mitochondrial sheathprobableGO:0005575, GO:0044463, GO:0043231, GO:0031514, GO:0036126, GO:0044441, GO:0044464, GO:0097223, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422
GO:0046939 [BP]nucleotide phosphorylationprobableGO:0006139, GO:0044710, GO:0044238, GO:0016310, GO:1901360, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0071704, GO:0006796, GO:0006807, GO:0009117, GO:0044281, GO:0008152, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0055086, GO:0046483
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AK2, chain A
Confidence level:very confident
Coverage over the Query: 31-131
View the alignment between query and template
View the model in PyMOL
Template: 3DL0, chain A
Confidence level:very confident
Coverage over the Query: 7-130
View the alignment between query and template
View the model in PyMOL