Psyllid ID: psy9245

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MIKSNQSHSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTKQRKDQVLFI
ccccccccccEEcccccccHHHHHccccccccccHHHHHHcccEEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHccccccccc
cccccccccEEEEcHHHHHHHccccEEEEEccHHHHHHHHcccEEcccccEEcccccccccccEccccccEcEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEc
miksnqshSFIILTQTELIrynqssssdvevplgldfRNRIGKYMRIIILVYLAKGYIQGLQKKLkvtgeplikrsDDNAEALKKRLESYhkqttplvDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCtkqrkdqvlfi
MIKSNQSHSFIILTQTELIRynqssssdvevplGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLkvtgeplikrsdDNAEALKKRLesyhkqttplVDYYQKKGLHYQVDAAKSSREVFNMIDRVFqnctkqrkdqvlfi
MIKSNQSHSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTKQRKDQVLFI
*********FIILTQTELIRYNQS**SDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPL*****************YHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCT**********
*IKSNQSHSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTKQR*D*VLFI
********SFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTKQ********
******SHSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTKQRKDQVLFI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKSNQSHSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTGEPLxxxxxxxxxxxxxxxxxxxxxTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTKQRKDQVLFI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
B4PAR6240 Adenylate kinase 2, mitoc N/A N/A 0.446 0.262 0.761 2e-23
B4QBH8240 Adenylate kinase 2, mitoc N/A N/A 0.489 0.287 0.694 9e-23
B4I2A8240 Adenylate kinase 2, mitoc N/A N/A 0.489 0.287 0.694 9e-23
B3NQ53240 Adenylate kinase 2, mitoc N/A N/A 0.439 0.258 0.758 1e-22
Q9U915240 Adenylate kinase 2, mitoc yes N/A 0.439 0.258 0.758 1e-22
B4MQT3240 Adenylate kinase 2, mitoc N/A N/A 0.489 0.287 0.680 2e-22
B3MCQ5240 Adenylate kinase 2, mitoc N/A N/A 0.439 0.258 0.741 3e-22
B4KLY1240 Adenylate kinase 2, mitoc N/A N/A 0.439 0.258 0.725 4e-22
Q290A8240 Adenylate kinase 2, mitoc yes N/A 0.482 0.283 0.676 6e-22
B4LP08240 Adenylate kinase 2, mitoc N/A N/A 0.482 0.283 0.676 9e-22
>sp|B4PAR6|KAD2_DROYA Adenylate kinase 2, mitochondrial OS=Drosophila yakuba GN=Adk2 PE=3 SV=1 Back     alignment and function desciption
 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (88%)

Query: 67  VTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRV 126
           VTGEPLI+RSDDNAEALKKRLE+YHKQT PLVDYY  +GLH++VDAAK S +VF+ ID +
Sbjct: 170 VTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFSTIDSI 229

Query: 127 FQN 129
           FQN
Sbjct: 230 FQN 232
Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth.
Drosophila yakuba (taxid: 7245)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 3
>sp|B4QBH8|KAD2_DROSI Adenylate kinase 2, mitochondrial OS=Drosophila simulans GN=Adk2 PE=3 SV=1 Back     alignment and function description
>sp|B4I2A8|KAD2_DROSE Adenylate kinase 2, mitochondrial OS=Drosophila sechellia GN=Adk2-1 PE=3 SV=1 Back     alignment and function description
>sp|B3NQ53|KAD2_DROER Adenylate kinase 2, mitochondrial OS=Drosophila erecta GN=Adk2 PE=3 SV=1 Back     alignment and function description
>sp|Q9U915|KAD2_DROME Adenylate kinase 2, mitochondrial OS=Drosophila melanogaster GN=Adk2 PE=1 SV=1 Back     alignment and function description
>sp|B4MQT3|KAD2_DROWI Adenylate kinase 2, mitochondrial OS=Drosophila willistoni GN=Adk2 PE=3 SV=1 Back     alignment and function description
>sp|B3MCQ5|KAD2_DROAN Adenylate kinase 2, mitochondrial OS=Drosophila ananassae GN=Adk2 PE=3 SV=1 Back     alignment and function description
>sp|B4KLY1|KAD2_DROMO Adenylate kinase 2, mitochondrial OS=Drosophila mojavensis GN=Adk2 PE=3 SV=1 Back     alignment and function description
>sp|Q290A8|KAD2_DROPS Adenylate kinase 2, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=Adk2 PE=3 SV=2 Back     alignment and function description
>sp|B4LP08|KAD2_DROVI Adenylate kinase 2, mitochondrial OS=Drosophila virilis GN=Adk2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
240848861 247 adenylate kinase 2, mitochondrial [Acyrt 0.531 0.303 0.631 7e-22
195489453240 GE14359 [Drosophila yakuba] gi|224493087 0.446 0.262 0.761 2e-21
195341784240 GM18289 [Drosophila sechellia] gi|195347 0.489 0.287 0.694 7e-21
194885988240 GG22922 [Drosophila erecta] gi|224493073 0.439 0.258 0.758 8e-21
195373222206 GM19270 [Drosophila sechellia] gi|194122 0.489 0.334 0.694 8e-21
22026816240 adenylate kinase-2 [Drosophila melanogas 0.439 0.258 0.758 9e-21
195430900240 GK21378 [Drosophila willistoni] gi|22449 0.489 0.287 0.680 1e-20
194754367240 GF12891 [Drosophila ananassae] gi|224493 0.439 0.258 0.741 2e-20
195122714240 GI20701 [Drosophila mojavensis] gi|22449 0.439 0.258 0.725 3e-20
195151257222 GL11651 [Drosophila persimilis] gi|19411 0.482 0.306 0.676 4e-20
>gi|240848861|ref|NP_001155593.1| adenylate kinase 2, mitochondrial [Acyrthosiphon pisum] gi|239788716|dbj|BAH71026.1| ACYPI004945 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 64/76 (84%), Gaps = 1/76 (1%)

Query: 67  VTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRV 126
           +TGE LI+R+DDN +ALKKRLESYHKQT+PL+DYYQKKG+H +VDA+KSS EVF M++ +
Sbjct: 172 ITGESLIRRADDNVDALKKRLESYHKQTSPLIDYYQKKGIHSKVDASKSSDEVFKMVEDI 231

Query: 127 FQNCTKQ-RKDQVLFI 141
           F  C+    KD+V+F+
Sbjct: 232 FLRCSSSANKDRVIFV 247

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195489453|ref|XP_002092744.1| GE14359 [Drosophila yakuba] gi|224493087|sp|B4PAR6.1|KAD2_DROYA RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2; AltName: Full=ATP-AMP transphosphorylase 2 gi|194178845|gb|EDW92456.1| GE14359 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195341784|ref|XP_002037485.1| GM18289 [Drosophila sechellia] gi|195347331|ref|XP_002040207.1| GM16084 [Drosophila sechellia] gi|195586291|ref|XP_002082911.1| GD11825 [Drosophila simulans] gi|224493083|sp|B4I2A8.1|KAD2_DROSE RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2; AltName: Full=ATP-AMP transphosphorylase 2 gi|224493084|sp|B4QBH8.1|KAD2_DROSI RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2; AltName: Full=ATP-AMP transphosphorylase 2 gi|194132335|gb|EDW53903.1| GM18289 [Drosophila sechellia] gi|194135556|gb|EDW57072.1| GM16084 [Drosophila sechellia] gi|194194920|gb|EDX08496.1| GD11825 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194885988|ref|XP_001976526.1| GG22922 [Drosophila erecta] gi|224493073|sp|B3NQ53.1|KAD2_DROER RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2; AltName: Full=ATP-AMP transphosphorylase 2 gi|190659713|gb|EDV56926.1| GG22922 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195373222|ref|XP_002046000.1| GM19270 [Drosophila sechellia] gi|194122905|gb|EDW44948.1| GM19270 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|22026816|ref|NP_523836.2| adenylate kinase-2 [Drosophila melanogaster] gi|74947162|sp|Q9U915.1|KAD2_DROME RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2; AltName: Full=ATP-AMP transphosphorylase 2 gi|17863032|gb|AAL39993.1| SD09634p [Drosophila melanogaster] gi|20043237|dbj|BAA87877.1| Dak2 [Drosophila melanogaster] gi|21626704|gb|AAF47139.2| adenylate kinase-2 [Drosophila melanogaster] gi|220944508|gb|ACL84797.1| Adk2-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195430900|ref|XP_002063486.1| GK21378 [Drosophila willistoni] gi|224493086|sp|B4MQT3.1|KAD2_DROWI RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2; AltName: Full=ATP-AMP transphosphorylase 2 gi|194159571|gb|EDW74472.1| GK21378 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194754367|ref|XP_001959467.1| GF12891 [Drosophila ananassae] gi|224493072|sp|B3MCQ5.1|KAD2_DROAN RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2; AltName: Full=ATP-AMP transphosphorylase 2 gi|190620765|gb|EDV36289.1| GF12891 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195122714|ref|XP_002005856.1| GI20701 [Drosophila mojavensis] gi|224493076|sp|B4KLY1.1|KAD2_DROMO RecName: Full=Adenylate kinase 2, mitochondrial; Short=AK 2; AltName: Full=ATP-AMP transphosphorylase 2 gi|193910924|gb|EDW09791.1| GI20701 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195151257|ref|XP_002016564.1| GL11651 [Drosophila persimilis] gi|194110411|gb|EDW32454.1| GL11651 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
FB|FBgn0022708240 Adk2 "Adenylate kinase-2" [Dro 0.439 0.258 0.758 1.9e-21
WB|WBGene00002879251 let-754 [Caenorhabditis elegan 0.524 0.294 0.573 9.5e-18
UNIPROTKB|E2RE39241 AK2 "Uncharacterized protein" 0.517 0.302 0.56 5.3e-17
MGI|MGI:87978239 Ak2 "adenylate kinase 2" [Mus 0.517 0.305 0.56 5.3e-17
RGD|2077239 Ak2 "adenylate kinase 2" [Ratt 0.517 0.305 0.546 5.3e-17
UNIPROTKB|P08166241 AK2 "Adenylate kinase 2, mitoc 0.517 0.302 0.56 8.6e-17
UNIPROTKB|I3LSI3247 AK2 "Uncharacterized protein" 0.517 0.295 0.56 8.6e-17
UNIPROTKB|P54819239 AK2 "Adenylate kinase 2, mitoc 0.517 0.305 0.533 1.8e-16
ZFIN|ZDB-GENE-030131-512241 ak2 "adenylate kinase 2" [Dani 0.517 0.302 0.546 1.3e-15
UNIPROTKB|F8VY04190 AK2 "Adenylate kinase 2, mitoc 0.460 0.342 0.538 2.6e-15
FB|FBgn0022708 Adk2 "Adenylate kinase-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 251 (93.4 bits), Expect = 1.9e-21, P = 1.9e-21
 Identities = 47/62 (75%), Positives = 55/62 (88%)

Query:    67 VTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRV 126
             VTGEPLI+RSDDNAEALKKRLE+YHKQT PLVDYY  +GLH++VDAAK S +VF+ ID +
Sbjct:   170 VTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFSTIDSI 229

Query:   127 FQ 128
             FQ
Sbjct:   230 FQ 231
GO:0005739 "mitochondrion" evidence=ISS;IDA
GO:0004017 "adenylate kinase activity" evidence=ISS;IMP;IDA
GO:0006172 "ADP biosynthetic process" evidence=ISS
GO:0005758 "mitochondrial intermembrane space" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0046939 "nucleotide phosphorylation" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
WB|WBGene00002879 let-754 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE39 AK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:87978 Ak2 "adenylate kinase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2077 Ak2 "adenylate kinase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P08166 AK2 "Adenylate kinase 2, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSI3 AK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P54819 AK2 "Adenylate kinase 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-512 ak2 "adenylate kinase 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F8VY04 AK2 "Adenylate kinase 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q28F55KAD2_XENTR2, ., 7, ., 4, ., 30.56570.51060.2987yesN/A
B2B0E2KAD1_PODAN2, ., 7, ., 4, ., 30.59010.43260.2210yesN/A
Q9WTP6KAD2_MOUSE2, ., 7, ., 4, ., 30.560.51770.3054yesN/A
P29410KAD2_RAT2, ., 7, ., 4, ., 30.54660.51770.3054yesN/A
Q5B2V8KAD1_EMENI2, ., 7, ., 4, ., 30.53960.44680.2432yesN/A
Q9U915KAD2_DROME2, ., 7, ., 4, ., 30.75800.43970.2583yesN/A
Q7QJX9KAD2_ANOGA2, ., 7, ., 4, ., 30.63010.49640.2916yesN/A
Q5REI7KAD2_PONAB2, ., 7, ., 4, ., 30.53330.51770.3054yesN/A
P08166KAD2_BOVIN2, ., 7, ., 4, ., 30.560.51770.3029yesN/A
P33075KAD1_SCHPO2, ., 7, ., 4, ., 30.54680.45390.2909yesN/A
Q4WJ21KAD1_ASPFU2, ., 7, ., 4, ., 30.56450.43970.2412yesN/A
P54819KAD2_HUMAN2, ., 7, ., 4, ., 30.53330.51770.3054yesN/A
Q1L8L9KAD2_DANRE2, ., 7, ., 4, ., 30.54660.51770.3029yesN/A
P0CO42KAD1_CRYNJ2, ., 7, ., 4, ., 30.50790.44680.2342yesN/A
P34346KAD2_CAEEL2, ., 7, ., 4, ., 30.57330.52480.2948yesN/A
Q54QJ9KAD2_DICDI2, ., 7, ., 4, ., 30.59010.43260.2210yesN/A
Q2UBH0KAD1_ASPOR2, ., 7, ., 4, ., 30.56450.43970.2403yesN/A
Q290A8KAD2_DROPS2, ., 7, ., 4, ., 30.67600.48220.2833yesN/A
Q74ZL1KAD1_ASHGO2, ., 7, ., 4, ., 30.56140.40420.2057yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
PRK00279215 PRK00279, adk, adenylate kinase; Reviewed 4e-20
TIGR01351210 TIGR01351, adk, adenylate kinase 1e-18
PLN02674244 PLN02674, PLN02674, adenylate kinase 3e-18
pfam00406186 pfam00406, ADK, Adenylate kinase 2e-17
cd01428194 cd01428, ADK, Adenylate kinase (ADK) catalyzes the 3e-17
TIGR01359183 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family 5e-13
PRK14527191 PRK14527, PRK14527, adenylate kinase; Provisional 1e-11
PRK13808 333 PRK13808, PRK13808, adenylate kinase; Provisional 1e-10
TIGR01360188 TIGR01360, aden_kin_iso1, adenylate kinase, isozym 3e-10
PRK14532188 PRK14532, PRK14532, adenylate kinase; Provisional 7e-10
PRK14531183 PRK14531, PRK14531, adenylate kinase; Provisional 7e-10
PRK14528186 PRK14528, PRK14528, adenylate kinase; Provisional 6e-09
PLN02200234 PLN02200, PLN02200, adenylate kinase family protei 4e-08
PRK02496184 PRK02496, adk, adenylate kinase; Provisional 7e-08
PRK14530215 PRK14530, PRK14530, adenylate kinase; Provisional 7e-08
COG0563178 COG0563, Adk, Adenylate kinase and related kinases 2e-07
PRK14526211 PRK14526, PRK14526, adenylate kinase; Provisional 1e-06
PLN02459261 PLN02459, PLN02459, probable adenylate kinase 1e-05
PTZ00088229 PTZ00088, PTZ00088, adenylate kinase 1; Provisiona 4e-04
PLN02842 505 PLN02842, PLN02842, nucleotide kinase 8e-04
>gnl|CDD|234711 PRK00279, adk, adenylate kinase; Reviewed Back     alignment and domain information 
 Score = 81.7 bits (203), Expect = 4e-20
 Identities = 33/63 (52%), Positives = 42/63 (66%)

Query: 67  VTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRV 126
           V GE LI+R+DDN E ++KRLE YHKQT PL+DYY+KKG   ++D   S  EVF  I + 
Sbjct: 152 VCGEELIQRADDNEETVRKRLEVYHKQTAPLIDYYKKKGKLKKIDGTGSIDEVFADILKA 211

Query: 127 FQN 129
              
Sbjct: 212 LGK 214

Length = 215
>gnl|CDD|233369 TIGR01351, adk, adenylate kinase Back     alignment and domain information
>gnl|CDD|178279 PLN02674, PLN02674, adenylate kinase Back     alignment and domain information
>gnl|CDD|201213 pfam00406, ADK, Adenylate kinase Back     alignment and domain information
>gnl|CDD|238713 cd01428, ADK, Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>gnl|CDD|130426 TIGR01359, UMP_CMP_kin_fam, UMP-CMP kinase family Back     alignment and domain information
>gnl|CDD|237745 PRK14527, PRK14527, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|130427 TIGR01360, aden_kin_iso1, adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>gnl|CDD|184729 PRK14532, PRK14532, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172997 PRK14531, PRK14531, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|172994 PRK14528, PRK14528, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|215125 PLN02200, PLN02200, adenylate kinase family protein Back     alignment and domain information
>gnl|CDD|179433 PRK02496, adk, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237747 PRK14530, PRK14530, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|223637 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|172992 PRK14526, PRK14526, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|215253 PLN02459, PLN02459, probable adenylate kinase Back     alignment and domain information
>gnl|CDD|240262 PTZ00088, PTZ00088, adenylate kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|178435 PLN02842, PLN02842, nucleotide kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
KOG3079|consensus195 99.94
PRK14526211 adenylate kinase; Provisional 99.93
PLN02674244 adenylate kinase 99.93
PLN02459261 probable adenylate kinase 99.88
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 99.88
PRK14529223 adenylate kinase; Provisional 99.87
PRK00279215 adk adenylate kinase; Reviewed 99.86
PRK14530215 adenylate kinase; Provisional 99.84
PTZ00088229 adenylate kinase 1; Provisional 99.84
KOG3078|consensus235 99.83
PRK14528186 adenylate kinase; Provisional 99.81
PRK14527191 adenylate kinase; Provisional 99.75
PRK14531183 adenylate kinase; Provisional 99.75
PRK13808 333 adenylate kinase; Provisional 99.71
PLN02842 505 nucleotide kinase 99.66
PLN02200234 adenylate kinase family protein 99.66
PRK02496184 adk adenylate kinase; Provisional 99.63
PRK14532188 adenylate kinase; Provisional 99.61
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 99.58
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 99.54
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 99.52
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 99.39
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 99.26
PRK13974212 thymidylate kinase; Provisional 98.96
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 98.35
PRK13973213 thymidylate kinase; Provisional 97.95
PHA02530 300 pseT polynucleotide kinase; Provisional 97.19
PRK14738206 gmk guanylate kinase; Provisional 96.86
PRK13975196 thymidylate kinase; Provisional 96.45
PRK08233182 hypothetical protein; Provisional 96.22
PRK01184184 hypothetical protein; Provisional 96.04
PRK00698205 tmk thymidylate kinase; Validated 95.81
PRK14731208 coaE dephospho-CoA kinase; Provisional 95.66
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 95.17
PRK08356195 hypothetical protein; Provisional 95.14
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 94.8
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 94.76
PRK03839180 putative kinase; Provisional 94.69
PRK03731171 aroL shikimate kinase II; Reviewed 94.68
PRK00300205 gmk guanylate kinase; Provisional 94.64
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.29
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 94.27
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 93.67
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 93.4
PRK07933213 thymidylate kinase; Validated 92.6
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 91.96
PRK14529223 adenylate kinase; Provisional 89.79
PLN02459261 probable adenylate kinase 88.19
PRK14734200 coaE dephospho-CoA kinase; Provisional 87.45
PRK13976209 thymidylate kinase; Provisional 86.58
PLN02674244 adenylate kinase 86.54
PRK00081194 coaE dephospho-CoA kinase; Reviewed 85.36
PLN02772398 guanylate kinase 85.09
PLN02924220 thymidylate kinase 84.81
PRK06217183 hypothetical protein; Validated 84.09
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 83.28
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 82.97
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 82.38
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 81.07
>KOG3079|consensus Back     alignment and domain information 
Probab=99.94  E-value=2.4e-27  Score=184.35  Aligned_cols=112  Identities=29%  Similarity=0.438  Sum_probs=101.4

Q ss_pred             CCCCCCcceeEeehhhhhhhhhccccCcccccchhhHHhhhC-cchhhhhhhhhhccCCCcchhhhhcccc-ccccCCCC
Q psy9245           1 MIKSNQSHSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIG-KYMRIIILVYLAKGYIQGLQKKLKVTGE-PLIKRSDD   78 (141)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~qa~~~pr~v~q~~~fer~i~-~~~~v~g~ly~~~~npP~~~~~~d~~~~-rL~~R~DD   78 (141)
                      |..+..+-+|||||            |||+++|+..||+.++ .+.+|   +|++|   |++.++.+++.+ +-..|.||
T Consensus        81 m~~~~~~~~fLIDG------------yPR~~~q~~~fe~~i~~~~~fv---l~fdc---~ee~~l~Rll~R~q~~~R~DD  142 (195)
T KOG3079|consen   81 MRSSGDSNGFLIDG------------YPRNVDQLVEFERKIQGDPDFV---LFFDC---PEETMLKRLLHRGQSNSRSDD  142 (195)
T ss_pred             HHhcCCCCeEEecC------------CCCChHHHHHHHHHhcCCCCEE---EEEeC---CHHHHHHHHHhhcccCCCCCC
Confidence            44556666799999            9999999999999999 68888   89999   899999898863 44459999


Q ss_pred             cHHHHHHHHHHHHhhcHHHHHHHhhcCCEEEEeCCCCHHHHHHHHHHHHHhh
Q psy9245          79 NAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNC  130 (141)
Q Consensus        79 ~~E~I~kRL~~Y~~~t~Pvi~~Y~~~g~l~~Ida~~sieeV~~~I~~~l~~~  130 (141)
                      |.++|++|+++|++.|.||++||+++|++++|||++++++||.+++++|+..
T Consensus       143 n~esikkR~et~~~~t~Pvi~~~e~kg~l~~i~a~~~~d~Vf~~v~~~id~~  194 (195)
T KOG3079|consen  143 NEESIKKRLETYNKSTLPVIEYYEKKGKLLKINAERSVDDVFEEVVTAIDAA  194 (195)
T ss_pred             chHHHHHHHHHHHHcchHHHHHHHccCcEEEecCCCCHHHHHHHHHHHhhcc
Confidence            9999999999999999999999999999999999999999999999998753

>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>KOG3078|consensus Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
2c9y_A242 Structure Of Human Adenylate Kinase 2 Length = 242 7e-18
1ak2_A233 Adenylate Kinase Isoenzyme-2 Length = 233 4e-17
1aky_A220 High-Resolution Structures Of Adenylate Kinase From 7e-14
3aky_A220 Stability, Activity And Structure Of Adenylate Kina 1e-13
1dvr_A220 Structure Of A Mutant Adenylate Kinase Ligated With 7e-13
3be4_A217 Crystal Structure Of Cryptosporidium Parvum Adenyla 6e-12
2rgx_A206 Crystal Structure Of Adenylate Kinase From Aquifex 1e-09
1z83_A196 Crystal Structure Of Human Ak1a In Complex With Ap5 1e-09
3adk_A195 Refined Structure Of Porcine Cytosolic Adenylate Ki 2e-09
3tlx_A243 Crystal Structure Of Pf10_0086, Adenylate Kinase Fr 8e-09
1zd8_A227 Structure Of Human Adenylate Kinase 3 Like 1 Length 1e-08
1tev_A196 Crystal Structure Of The Human UmpCMP KINASE IN OPE 3e-08
2ak3_A226 The Three-Dimensional Structure Of The Complex Betw 5e-08
3cm0_A186 Crystal Structure Of Adenylate Kinase From Thermus 1e-07
3gmt_A230 Crystal Structure Of Adenylate Kinase From Burkhold 2e-07
1e4y_A214 Mutant P9l Of Adenylate Kinase From E. Coli, Modifi 1e-06
1ake_A214 Structure Of The Complex Between Adenylate Kinase F 1e-06
1e4v_A214 Mutant G10v Of Adenylate Kinase From E. Coli, Modif 1e-06
3dl0_A216 Crystal Structure Of Adenylate Kinase Variant Aklse 3e-06
2ori_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 4e-06
2qaj_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 4e-06
2osb_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 4e-06
2eu8_A216 Crystal Structure Of A Thermostable Mutant Of Bacil 4e-06
2p3s_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 4e-06
1p3j_A217 Adenylate Kinase From Bacillus Subtilis Length = 21 5e-06
3hpr_A214 Crystal Structure Of V148g Adenylate Kinase From E. 5e-06
2ar7_A246 Crystal Structure Of Human Adenylate Kinase 4, Ak4 9e-06
3fb4_A216 Crystal Structure Of Adenylate Kinase From Mariniba 1e-05
2oo7_A217 Crystal Structure Of A Thermostable Mutant Of Bacil 2e-05
1s3g_A217 Crystal Structure Of Adenylate Kinase From Bacillus 2e-05
1zin_A217 Adenylate Kinase With Bound Ap5a Length = 217 4e-05
3ndp_A231 Crystal Structure Of Human Ak4(L171p) Length = 231 5e-05
3dkv_A217 Crystal Structure Of Adenylate Kinase Variant Aklse 6e-05
1qf9_A194 Ph Influences Fluoride Coordination Number Of The A 2e-04
2bwj_A199 Structure Of Adenylate Kinase 5 Length = 199 2e-04
>pdb|2C9Y|A Chain A, Structure Of Human Adenylate Kinase 2 Length = 242 Back     alignment and structure 
Iteration: 1

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 2/75 (2%)
Query: 67  VTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRV 126
           +TGEPLI+RSDDN +ALK RL++YH QTTPL++YY+K+G+H  +DA+++   VF  I   
Sbjct: 168 ITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAA 227
Query: 127 FQNCTKQRKDQVLFI 141
           F   T   KD V+FI
Sbjct: 228 FSKATC--KDLVMFI 240
>pdb|1AK2|A Chain A, Adenylate Kinase Isoenzyme-2 Length = 233 Back     alignment and structure
>pdb|1AKY|A Chain A, High-Resolution Structures Of Adenylate Kinase From Yeast Ligated With Inhibitor Ap5a, Showing The Pathway Of Phosphoryl Transfer Length = 220 Back     alignment and structure
>pdb|3AKY|A Chain A, Stability, Activity And Structure Of Adenylate Kinase Mutants Length = 220 Back     alignment and structure
>pdb|1DVR|A Chain A, Structure Of A Mutant Adenylate Kinase Ligated With An Atp- Analogue Showing Domain Closure Over Atp Length = 220 Back     alignment and structure
>pdb|3BE4|A Chain A, Crystal Structure Of Cryptosporidium Parvum Adenylate Kinase Cgd5_3360 Length = 217 Back     alignment and structure
>pdb|2RGX|A Chain A, Crystal Structure Of Adenylate Kinase From Aquifex Aeolicus In Complex With Ap5a Length = 206 Back     alignment and structure
>pdb|1Z83|A Chain A, Crystal Structure Of Human Ak1a In Complex With Ap5a Length = 196 Back     alignment and structure
>pdb|3ADK|A Chain A, Refined Structure Of Porcine Cytosolic Adenylate Kinase At 2.1 Angstroms Resolution Length = 195 Back     alignment and structure
>pdb|3TLX|A Chain A, Crystal Structure Of Pf10_0086, Adenylate Kinase From Plasmodium Falciparum Length = 243 Back     alignment and structure
>pdb|1ZD8|A Chain A, Structure Of Human Adenylate Kinase 3 Like 1 Length = 227 Back     alignment and structure
>pdb|1TEV|A Chain A, Crystal Structure Of The Human UmpCMP KINASE IN OPEN Conformation Length = 196 Back     alignment and structure
>pdb|2AK3|A Chain A, The Three-Dimensional Structure Of The Complex Between Mitochondrial Matrix Adenylate Kinase And Its Substrate Amp At 1.85 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|3CM0|A Chain A, Crystal Structure Of Adenylate Kinase From Thermus Thermophilus Hb8 Length = 186 Back     alignment and structure
>pdb|3GMT|A Chain A, Crystal Structure Of Adenylate Kinase From Burkholderia Pseu Length = 230 Back     alignment and structure
>pdb|1E4Y|A Chain A, Mutant P9l Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|1AKE|A Chain A, Structure Of The Complex Between Adenylate Kinase From Escherichia Coli And The Inhibitor Ap5a Refined At 1.9 Angstroms Resolution: A Model For A Catalytic Transition State Length = 214 Back     alignment and structure
>pdb|1E4V|A Chain A, Mutant G10v Of Adenylate Kinase From E. Coli, Modified In The Gly-Loop Length = 214 Back     alignment and structure
>pdb|3DL0|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse3 Length = 216 Back     alignment and structure
>pdb|2ORI|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (A193vQ199R) Length = 216 Back     alignment and structure
>pdb|2QAJ|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199rG213E) Length = 217 Back     alignment and structure
>pdb|2OSB|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (q16l/q199r/) Length = 216 Back     alignment and structure
>pdb|2EU8|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (Q199r) Length = 216 Back     alignment and structure
>pdb|2P3S|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (G214rQ199R) Length = 217 Back     alignment and structure
>pdb|1P3J|A Chain A, Adenylate Kinase From Bacillus Subtilis Length = 217 Back     alignment and structure
>pdb|3HPR|A Chain A, Crystal Structure Of V148g Adenylate Kinase From E. Coli, In Complex With Ap5a Length = 214 Back     alignment and structure
>pdb|2AR7|A Chain A, Crystal Structure Of Human Adenylate Kinase 4, Ak4 Length = 246 Back     alignment and structure
>pdb|3FB4|A Chain A, Crystal Structure Of Adenylate Kinase From Marinibacillus Marinus Length = 216 Back     alignment and structure
>pdb|2OO7|A Chain A, Crystal Structure Of A Thermostable Mutant Of Bacillus Subtilis Adenylate Kinase (T179iQ199R) Length = 217 Back     alignment and structure
>pdb|1S3G|A Chain A, Crystal Structure Of Adenylate Kinase From Bacillus Globisporus Length = 217 Back     alignment and structure
>pdb|1ZIN|A Chain A, Adenylate Kinase With Bound Ap5a Length = 217 Back     alignment and structure
>pdb|3NDP|A Chain A, Crystal Structure Of Human Ak4(L171p) Length = 231 Back     alignment and structure
>pdb|3DKV|A Chain A, Crystal Structure Of Adenylate Kinase Variant Aklse1 Length = 217 Back     alignment and structure
>pdb|1QF9|A Chain A, Ph Influences Fluoride Coordination Number Of The Alfx Phosphoryl Transfer Transition State Analog In UmpCMP Kinase Length = 194 Back     alignment and structure
>pdb|2BWJ|A Chain A, Structure Of Adenylate Kinase 5 Length = 199 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 1e-26
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 4e-26
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 4e-26
3tlx_A243 Adenylate kinase 2; structural genomics, structura 7e-26
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 1e-25
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 2e-25
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 2e-25
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 2e-25
2rgx_A206 Adenylate kinase; transferase(phosphotransferase), 5e-25
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 2e-23
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 3e-23
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 1e-20
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 9e-19
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 2e-18
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 3e-18
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 3e-18
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 5e-18
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 6e-18
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 4e-17
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 1e-15
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Length = 233 Back     alignment and structure
 Score = 98.4 bits (246), Expect = 1e-26
 Identities = 37/65 (56%), Positives = 48/65 (73%)

Query: 67  VTGEPLIKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRV 126
           +TGEPLI+RSDDN +ALK RLE+YH QTTPLV+YY K+G+H  +DA+++   VF  I   
Sbjct: 168 ITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAA 227

Query: 127 FQNCT 131
           F   T
Sbjct: 228 FSKAT 232
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Length = 217 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Length = 220 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Length = 243 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Length = 216 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Length = 227 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, cytoplasm, metal-binding, nucleotide biosynthesis, nucleotide-binding; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Length = 216 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Length = 246 Back     alignment and structure
>2rgx_A Adenylate kinase; transferase(phosphotransferase), ATP-binding, nucleo binding, transferase; HET: AP5; 1.90A {Aquifex aeolicus} PDB: 2rh5_A Length = 206 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Length = 222 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Length = 214 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 230 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Length = 186 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Length = 199 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Length = 196 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Length = 194 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Length = 203 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Length = 196 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Length = 223 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Length = 201 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 99.94
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 99.9
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 99.89
3tlx_A243 Adenylate kinase 2; structural genomics, structura 99.84
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 99.8
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 99.77
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 99.66
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 99.62
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 99.62
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 99.62
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 99.54
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 99.53
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 99.22
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.22
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 99.11
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.07
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 99.04
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 99.02
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 99.01
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.0
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.87
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.88
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.33
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.03
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 96.87
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 96.8
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 96.8
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 96.66
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 96.63
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.62
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.37
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 96.36
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 96.29
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.27
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.2
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.05
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 95.8
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.66
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 95.59
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 95.55
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.78
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.66
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.48
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.36
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.34
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.86
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.76
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 93.19
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.87
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 92.59
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 92.52
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.44
1via_A175 Shikimate kinase; structural genomics, transferase 92.05
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 91.59
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 91.49
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 90.6
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 90.55
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 90.46
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 90.2
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 89.52
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 89.36
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 89.06
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 88.06
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 87.93
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 86.55
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 86.48
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 86.46
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 85.42
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 85.4
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 85.36
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 85.15
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 85.01
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 82.73
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 81.63
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 81.62
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 80.78
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
Probab=99.94  E-value=6.9e-28  Score=191.76  Aligned_cols=120  Identities=25%  Similarity=0.328  Sum_probs=90.6

Q ss_pred             ceeEeehhhhhhhhhccccCcc-----------cccchhhHHhhhCcchh-hhhhhhhhccCCCcchhhhhccccccccC
Q psy9245           8 HSFIILTQTELIRYNQSSSSDV-----------EVPLGLDFRNRIGKYMR-IIILVYLAKGYIQGLQKKLKVTGEPLIKR   75 (141)
Q Consensus         8 ~~~~~~~~~~~~~~~qa~~~pr-----------~v~q~~~fer~i~~~~~-v~g~ly~~~~npP~~~~~~d~~~~rL~~R   75 (141)
                      -.||+||  ++++..||+.|..           +++....++|..+|... .+|++||..||||+.+++||.|+++|++|
T Consensus        87 ~g~ILDG--fPRt~~Qa~~L~~~~~~~d~VI~Ldvp~e~l~~Rl~~R~~~~~~G~~Yh~~~~pp~~~~~~d~~g~~L~~R  164 (230)
T 3gmt_A           87 NGYLFDG--FPRTIAQADAMKEAGVAIDYVLEIDVPFSEIIERMSGRRTHPASGRTYHVKFNPPKVEGKDDVTGEPLVQR  164 (230)
T ss_dssp             TCEEEES--CCCSHHHHHHHHHTTCCCSEEEEECCCHHHHHHHHHTEEEETTTTEEEETTTBCCSSTTBCTTTCCBCBCC
T ss_pred             CCeEecC--CCCcHHHHHHHHHhCCCccEEEEEeCCHHHHHHHHHcCCcccccCCcccccCCCCCccCcCCCccCccccC
Confidence            3699999  7888888876432           45677777788887643 78999999999999999999999999999


Q ss_pred             CCCcHHHHHHHHHHHHhhcHHHHHHHhhc-----------CCEEEEeCCCCHHHHHHHHHHHHHh
Q psy9245          76 SDDNAEALKKRLESYHKQTTPLVDYYQKK-----------GLHYQVDAAKSSREVFNMIDRVFQN  129 (141)
Q Consensus        76 ~DD~~E~I~kRL~~Y~~~t~Pvi~~Y~~~-----------g~l~~Ida~~sieeV~~~I~~~l~~  129 (141)
                      +||++|+|++||+.|+++|.||++||+++           |+++.|||++++++||++|+++|.+
T Consensus       165 ~DD~~e~i~~Rl~~y~~~t~pl~~~Y~~~~~~~~~~~~~~~~l~~idg~~~~~eV~~~i~~~l~~  229 (230)
T 3gmt_A          165 DDDKEETVKKRLDVYEAQTKPLITYYGDWARRGAENGLKAPAYRKISGLGAVEEIRARVRRAQVS  229 (230)
T ss_dssp             GGGSHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCBTTBCCCEEEEECC-----------------
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHhhhcccccccccCCeEEEEECCCCHHHHHHHHHHHHhc
Confidence            99999999999999999999999999973           8999999999999999999998865
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 141
d2ak3a1189 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow 3e-11
d1ak2a1190 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co 9e-11
d3adka_194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 2e-10
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 3e-10
d1ukza_196 c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac 1e-09
d1s3ga1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 1e-09
d1teva_194 c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) 1e-09
d1akya1180 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Bak 9e-09
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 3e-08
d1zina1182 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac 3e-08
d1e4va1179 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Esc 6e-06
d2cdna1181 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium 2e-05
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]

 Score = 56.4 bits (135), Expect = 3e-11
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 73  IKRSDDNAEALKKRLESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNCTK 132
            +R  D  E + KRL++Y  QT P+++YY+KKG+       +++ +++  +    Q    
Sbjct: 121 KQRLTDRPETVVKRLKAYEAQTEPVLEYYRKKGVLETFSGTETN-KIWPHVYAFLQTKLP 179

Query: 133 QRKDQ 137
           QR  +
Sbjct: 180 QRSQE 184
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Length = 182 Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 182 Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 99.74
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 99.7
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.67
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.66
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 99.64
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 99.6
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 99.58
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.54
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 99.5
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 99.48
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 99.46
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 99.43
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 98.77
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 98.57
d1ak2a230 Microbial and mitochondrial ADK, insert "zinc fing 98.52
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 98.2
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 98.12
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 98.06
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.56
d1zaka231 Microbial and mitochondrial ADK, insert "zinc fing 97.41
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.37
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.97
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.44
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.17
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.04
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.62
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.41
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.96
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 92.62
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.45
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.57
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 89.5
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 87.55
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 84.17
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 80.67
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=99.74  E-value=8e-19  Score=130.71  Aligned_cols=105  Identities=30%  Similarity=0.476  Sum_probs=90.9

Q ss_pred             ceeEeehhhhhhhhhccccCcccccchhhHHhhhCcchhhhhhhhhhccCCCcchhhhhccc-cccccCCCCcHHHHHHH
Q psy9245           8 HSFIILTQTELIRYNQSSSSDVEVPLGLDFRNRIGKYMRIIILVYLAKGYIQGLQKKLKVTG-EPLIKRSDDNAEALKKR   86 (141)
Q Consensus         8 ~~~~~~~~~~~~~~~qa~~~pr~v~q~~~fer~i~~~~~v~g~ly~~~~npP~~~~~~d~~~-~rL~~R~DD~~E~I~kR   86 (141)
                      -.|++||            |||+..|+..|+..++.++.+   +++.+   |......+... .++.+|.||++|++++|
T Consensus        88 ~g~ildg------------~pr~~~qa~~~~~~~~~~~~~---~~~~~---~~~~~~~r~~~~~~~~~r~~d~~e~i~~R  149 (194)
T d3adka_          88 KGFLIDG------------YPREVKQGEEFERKIGQPTLL---LYVDA---GPETMTKRLLKRGETSGRVDDNEETIKKR  149 (194)
T ss_dssp             SCEEEES------------CCSSHHHHHHHHHHTCCCSEE---EEEEC---CHHHHHHHHHHHHHHHTCCCCCSTTHHHH
T ss_pred             ccceeee------------ccchhHHHHHHHHHhCCccch---hcccc---chhhhHhHhhhhcccccCCcchHHHHHHH
Confidence            3488888            999999999999999988865   56666   55555555544 35778999999999999


Q ss_pred             HHHHHhhcHHHHHHHhhcCCEEEEeCCCCHHHHHHHHHHHHHhh
Q psy9245          87 LESYHKQTTPLVDYYQKKGLHYQVDAAKSSREVFNMIDRVFQNC  130 (141)
Q Consensus        87 L~~Y~~~t~Pvi~~Y~~~g~l~~Ida~~sieeV~~~I~~~l~~~  130 (141)
                      ++.|++++.|+++||++.+.++.|||++++++||++|++.|++.
T Consensus       150 ~~~y~~~~~~~~~~y~~~~~~~~Id~~~s~~eV~~~I~~~i~~l  193 (194)
T d3adka_         150 LETYYKATEPVIAFYEKRGIVRKVNAEGSVDDVFSQVCTHLDTL  193 (194)
T ss_dssp             HHHHHHHTHHHHHHHTTTTCEEEEECCSCHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHhcCCEEEEECCCCHHHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999864
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ak2a2 g.41.2.1 (A:147-176) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1zaka2 g.41.2.1 (A:128-158) Microbial and mitochondrial ADK, insert "zinc finger" domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure