Diaphorina citri psyllid: psy9266


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MKIYADADFSNVEVTLVNADLWQNFHAIGTEMIITKTGRTKISTRGRMFPSLQLQVSGLDQAAHYSLLVEFHLASPHKYKYKTSWEPVGDAERPIAHPAARLYSHPAGHALGSFWTGQTLHLNKIKLANAFVEGTRFLEVRHLLLIYPQCGQIQSDM
ccccccccccccEEEEccHHHHHHHHccccEEEEEccccccccccccccccEEEEEEcccccccEEEEEEEEEcccccEEccccEEECcccccccccccccEEEccccccccHHHHcccccccEEEEEcccccccccEEEcccccccCEEEEEEccc
********FSNVEVTLVNADLWQNFHAIGTEMIITKTGRTKISTRGRMFPSLQLQVSGLDQAAHYSLLVEFHLASPHKYKYKTSWEPVGDAERPIAHPAARLYSHPAGHALGSFWTGQTLHLNKIKLANAFVEGTRFLEVRHLLLIYPQCGQIQSDM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIYADADFSNVEVTLVNADLWQNFHAIGTEMIITKTGRTKISTRGRMFPSLQLQVSGLDQAAHYSLLVEFHLASPHKYKYKTSWEPVGDAERPIAHPAARLYSHPAGHALGSFWTGQTLHLNKIKLANAFVEGTRFLEVRHLLLIYPQCGQIQSDM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0000977 [MF]RNA polymerase II regulatory region sequence-specific DNA bindingprobableGO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044451 [CC]nucleoplasm partprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001104 [MF]RNA polymerase II transcription cofactor activityprobableGO:0001076, GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0001191 [MF]RNA polymerase II transcription factor binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001076, GO:0003674, GO:0000989, GO:0000988
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X6U, chain A
Confidence level:very confident
Coverage over the Query: 10-156
View the alignment between query and template
View the model in PyMOL