Diaphorina citri psyllid: psy9275

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----

MEWRALKALKGKSTLKVLVILVELGYLSSNRERERDELLREKELKEKVDHLTYQMEWRALKGNATFSESAAPPGSDRAKLEVLEKVIEGYRQRMEHIEADQGLVCVIPGQNSEKVAQQKVQELQMEADNNRETVKQMAGMQKLNSKIKSLELQGKRLREVYKAAKLNNKIKSLELQGKRLREVYKAASQEFRETVYLLFGYKVDRTNCMYKLASMYADGPDENLLFQSTEGQLNLIETDYSKVLKPLLDLHLGRHHSIPMLLSALTQELFQRQTMSMTNSTLSV

cHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccEEEEEEcccccccccEEEEEccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccc

****ALK****KSTLKVLVILVELGYLS*******************VDHLTYQMEWRALK*******************EVLEKVIEGYRQRMEHIEADQGLVCVIP******************A*****************************LREVYKAAKLNNKIKSLELQGKRLREVYKAASQEFRETVYLLFGYKVDRTNCMYKLASMYADGPDENLLFQSTEGQLNLIETDYSKVLKPLLDLHLGRHHSIPMLLSALTQELFQRQTM*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEWRALKALKGKSTLKVLVILVELGYLSSNRERERDELLREKELKEKVDHLTYQMEWRALKGNATFSESAAPPGSDRAKxxxxxxxxxxxxxxxxxxxxxQGLVCVIPGQNSxxxxxxxxxxxxxxxxxxxxxVKQMAGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFRETVYLLFGYKVDRTNCMYKLASMYADGPDENLLFQSTEGQLNLIETDYSKVLKPLLDLHLGRHHSIPMLLSALTQELFQRQTMSMTNSTLSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044430 [CC]	cytoskeletal part	probable	GO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015629 [CC]	actin cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0015630 [CC]	microtubule cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0000776 [CC]	kinetochore	probable	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DZO, chain A
Confidence level:very confident
Coverage over the Query: 161-274
View the alignment between query and template
View the model in PyMOL

Template: 1GO4, chain E
Confidence level:confident
Coverage over the Query: 71-158
View the alignment between query and template
View the model in PyMOL