Diaphorina citri psyllid: psy9276

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580---

MEEDPPIQHQEIIEEGLREEEVGLEPDLSKVKEEVIIKMEPEDDVDPEAESLNRRGMPRRTIKKNRYIFDDMFNAGATSPRVNKTPNKTPTKKATPNSKKKKTPTSLVKFSSSSKLQSTLTETPEKFNDSKLKGSKKSRVRCSSPDRNLGQRVGMKLRNLLKLPKAYRFVCYEFFYSNIDRPLFNDNDFITCMKESFPQLKKYVFSRTEWSMVRRMVGKPRRCSSSFFTEERINLERRRNVIRYLQQGKCGDQTTVKDIPSEIPIQLVVGTKVTARVRSPQDGLFTGVVDAYDTSNNTYRITFDRQGLGTQSIPDYEVLSNDTPETLNRQSFLQMFFASVPNDHTNRTGKPEPEAMDANHIDKELEGMLGEYPVELLEQVVRFKKLLKFKKTEVYQIRDMNSEAERRQLYGEPYDRAFQKKYAGHILRLEKINKDVNTVLASLSVNLKKLSVTSENMSSQLYALSPSDLQQETYIAAQEIVDTVNKKNGNKIVDDQPVVSLITDLTALVLQIKTLSHSSRSAYEVEVLNKTMSDIYKKLSPNNQSVFENCIGVHMEQIKAALAGERGSLATLTKPVSQNTFNK

cccccccccHHHHHHHHcccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccEEEccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEccccccccCEEEEEECccccEEEEEEccccccCEEEcccccccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc

********************************************************************************************************************************************************VGMKLRNLLKLPKAYRFVCYEFFYSNIDRPLFNDNDFITCMKESFPQLKKYVFSRTEWSMVRRMVGKPRRCSSSFFTEERINLERRRNVIRYLQQGKCGDQTTVKDIPSEIPIQLVVGTKVTARVRSPQDGLFTGVVDAYDTSNNTYRITFDRQGLGTQSIPDYEVLSNDTPETLNRQSFLQMFFA*****************************MLGEYPVELLEQVVRFKKLLKFKKTEVYQIRDMN****RRQLYGEPYDRAFQKKYAGHILRLEKINKDVNTVLASLSVNLKKLSV*********Y******LQQETYIAAQEIVDTVNKKNGNKIVDDQPVVSLITDLTALVLQIKTLSHSSRSAYEVEVLNKTMSDIYKKLSPNNQSVFENCIGVHMEQIKAALAGERGSL**************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein lin-9 homolog	Acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition.	confident	Q5TKA1
Protein lin-9	Synthetic multivulva class B (synMuvB) protein. SynMuvB proteins are required to repress the induction of vulval development by Ras signaling and probably act by forming the multiprotein DRM complex that repress transcription. Required for the development of sheath cells in the hermaphrodite gonad and for the development of the male spicule, rays and gonad.	confident	P30630
Protein lin-9 homolog	Acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition.	confident	Q8C735

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L8D, chain A
Confidence level:probable
Coverage over the Query: 264-321
View the alignment between query and template
View the model in PyMOL