Diaphorina citri psyllid: psy9278


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MGSQCKLDKPQIICLVEKSLDYQLFDCKWMPCSAKFIVLGMKPKGTGSIQMYEINDGQPELVKTVEKPNAFKCGTFNASPLSERYLATGDFEGKLQIW
ccccccccccEEEEEEHHccccCEEEEEEEcccccEEEEcccccccccEEEEEEccccEEEEEEEcccccCEEECcccccccccEEEEECcccCEEEc
********KPQIICLVEKSLDYQLFDCKWMPCSAKFIVLGMKPKGTGSIQMYEINDGQPELVKTVEKPNAFKCGTFNASPLSERYLATGDFEGKLQIW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSQCKLDKPQIICLVEKSLDYQLFDCKWMPCSAKFIVLGMKPKGTGSIQMYEINDGQPELVKTVEKPNAFKCGTFNASPLSERYLATGDFEGKLQIW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein 92 Seems to act as a modulator of apoptosis.confidentQ29RZ9
WD repeat-containing protein 92 Seems to act as a modulator of apoptosis.confidentA4QNE6
WD repeat-containing protein 92 Seems to act as a modulator of apoptosis.confidentQ561Y0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035064 [MF]methylated histone residue bindingprobableGO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0034968 [BP]histone lysine methylationprobableGO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I2N, chain A
Confidence level:very confident
Coverage over the Query: 8-98
View the alignment between query and template
View the model in PyMOL