Psyllid ID: psy9278
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 98 | ||||||
| 405971711 | 355 | WD repeat-containing protein 92 [Crassos | 0.938 | 0.259 | 0.652 | 3e-31 | |
| 332027634 | 357 | WD repeat-containing protein 92 [Acromyr | 0.948 | 0.260 | 0.645 | 6e-31 | |
| 405955292 | 162 | WD repeat-containing protein 92 [Crassos | 0.938 | 0.567 | 0.652 | 1e-30 | |
| 260830383 | 355 | hypothetical protein BRAFLDRAFT_216906 [ | 0.938 | 0.259 | 0.652 | 1e-30 | |
| 156552307 | 357 | PREDICTED: WD repeat-containing protein | 0.948 | 0.260 | 0.645 | 1e-30 | |
| 322788169 | 357 | hypothetical protein SINV_06071 [Solenop | 0.948 | 0.260 | 0.634 | 2e-30 | |
| 307177454 | 357 | WD repeat-containing protein 92 [Campono | 0.948 | 0.260 | 0.645 | 3e-30 | |
| 307202569 | 357 | WD repeat-containing protein 92 [Harpegn | 0.948 | 0.260 | 0.623 | 3e-30 | |
| 242019997 | 354 | conserved hypothetical protein [Pediculu | 0.938 | 0.259 | 0.619 | 5e-30 | |
| 308321262 | 358 | WD repeat-containing protein 92 [Ictalur | 0.938 | 0.256 | 0.597 | 3e-29 |
| >gi|405971711|gb|EKC36534.1| WD repeat-containing protein 92 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
Score = 138 bits (348), Expect = 3e-31, Method: Composition-based stats.
Identities = 60/92 (65%), Positives = 74/92 (80%)
Query: 7 LDKPQIICLVEKSLDYQLFDCKWMPCSAKFIVLGMKPKGTGSIQMYEINDGQPELVKTVE 66
+DKPQII +EKSLDY LFD KW+PCSAKF+VLG +GTG+IQ+YE++ GQ VK +E
Sbjct: 1 MDKPQIIAHIEKSLDYTLFDTKWIPCSAKFVVLGSHARGTGAIQIYELSHGQINCVKEIE 60
Query: 67 KPNAFKCGTFNASPLSERYLATGDFEGKLQIW 98
K A KCGTF AS L +RYLATGDF+G++QIW
Sbjct: 61 KAKALKCGTFGASSLQQRYLATGDFDGRMQIW 92
|
Source: Crassostrea gigas Species: Crassostrea gigas Genus: Crassostrea Family: Ostreidae Order: Ostreoida Class: Bivalvia Phylum: Mollusca Superkingdom: Eukaryota |
| >gi|332027634|gb|EGI67702.1| WD repeat-containing protein 92 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|405955292|gb|EKC22462.1| WD repeat-containing protein 92 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|260830383|ref|XP_002610140.1| hypothetical protein BRAFLDRAFT_216906 [Branchiostoma floridae] gi|229295504|gb|EEN66150.1| hypothetical protein BRAFLDRAFT_216906 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|156552307|ref|XP_001600814.1| PREDICTED: WD repeat-containing protein 92-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|322788169|gb|EFZ13951.1| hypothetical protein SINV_06071 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307177454|gb|EFN66581.1| WD repeat-containing protein 92 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307202569|gb|EFN81904.1| WD repeat-containing protein 92 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242019997|ref|XP_002430444.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515582|gb|EEB17706.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|308321262|gb|ADO27783.1| WD repeat-containing protein 92 [Ictalurus furcatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 98 | ||||||
| UNIPROTKB|Q29RZ9 | 357 | WDR92 "WD repeat-containing pr | 0.928 | 0.254 | 0.582 | 5.7e-27 | |
| RGD|1563863 | 357 | Wdr92 "WD repeat domain 92" [R | 0.928 | 0.254 | 0.549 | 8.4e-26 | |
| UNIPROTKB|F1SJ04 | 668 | LOC100515478 "Uncharacterized | 0.928 | 0.136 | 0.571 | 9.4e-26 | |
| UNIPROTKB|F1PZ86 | 686 | WDR92 "Uncharacterized protein | 0.989 | 0.141 | 0.525 | 1e-25 | |
| UNIPROTKB|Q96MX6 | 357 | WDR92 "WD repeat-containing pr | 0.928 | 0.254 | 0.549 | 1.1e-25 | |
| ZFIN|ZDB-GENE-050417-93 | 358 | wdr92 "WD repeat domain 92" [D | 0.938 | 0.256 | 0.532 | 2.2e-25 | |
| MGI|MGI:2144224 | 357 | Wdr92 "WD repeat domain 92" [M | 0.928 | 0.254 | 0.538 | 2.6e-24 | |
| DICTYBASE|DDB_G0291822 | 357 | wdr92 "WD40 repeat-containing | 0.846 | 0.232 | 0.340 | 4.8e-06 |
| UNIPROTKB|Q29RZ9 WDR92 "WD repeat-containing protein 92" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 303 (111.7 bits), Expect = 5.7e-27, P = 5.7e-27
Identities = 53/91 (58%), Positives = 67/91 (73%)
Query: 8 DKPQIICLVEKSLDYQLFDCKWMPCSAKFIVLGMKPKGTGSIQMYEINDGQPELVKTVEK 67
+KPQII ++KSL Y +FDCKWMPCSAKF+ +G +GTG IQ+YEI G +L++ +EK
Sbjct: 5 EKPQIISHIQKSLSYTVFDCKWMPCSAKFVTMGNFARGTGVIQLYEIQQGDLKLLREIEK 64
Query: 68 PNAFKCGTFNASPLSERYLATGDFEGKLQIW 98
KCGTF A+ L +RYLATGDF G L IW
Sbjct: 65 AKPIKCGTFGATSLQQRYLATGDFAGNLHIW 95
|
|
| RGD|1563863 Wdr92 "WD repeat domain 92" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SJ04 LOC100515478 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PZ86 WDR92 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96MX6 WDR92 "WD repeat-containing protein 92" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050417-93 wdr92 "WD repeat domain 92" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2144224 Wdr92 "WD repeat domain 92" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291822 wdr92 "WD40 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 98 | |||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 97.8 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 97.5 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 97.48 | |
| PTZ00421 | 493 | coronin; Provisional | 97.29 | |
| KOG1587|consensus | 555 | 97.24 | ||
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 97.14 | |
| KOG0266|consensus | 456 | 96.93 | ||
| KOG0266|consensus | 456 | 96.92 | ||
| KOG0321|consensus | 720 | 96.9 | ||
| KOG0647|consensus | 347 | 96.88 | ||
| PTZ00421 | 493 | coronin; Provisional | 96.79 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 96.65 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 96.64 | |
| KOG0296|consensus | 399 | 96.61 | ||
| PTZ00420 | 568 | coronin; Provisional | 96.41 | |
| PTZ00420 | 568 | coronin; Provisional | 96.34 | |
| KOG0645|consensus | 312 | 96.32 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 96.29 | |
| KOG0277|consensus | 311 | 96.22 | ||
| KOG0310|consensus | 487 | 96.11 | ||
| KOG0645|consensus | 312 | 96.06 | ||
| KOG0294|consensus | 362 | 95.46 | ||
| KOG0277|consensus | 311 | 95.45 | ||
| KOG2055|consensus | 514 | 95.22 | ||
| KOG0264|consensus | 422 | 95.02 | ||
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 94.98 | |
| KOG0318|consensus | 603 | 94.8 | ||
| KOG2106|consensus | 626 | 94.7 | ||
| KOG0284|consensus | 464 | 94.34 | ||
| KOG0315|consensus | 311 | 94.01 | ||
| KOG1274|consensus | 933 | 93.61 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 92.6 | |
| KOG1587|consensus | 555 | 91.97 | ||
| KOG0269|consensus | 839 | 91.91 | ||
| KOG0772|consensus | 641 | 91.73 | ||
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 91.46 | |
| KOG0269|consensus | 839 | 91.44 | ||
| KOG0272|consensus | 459 | 90.96 | ||
| KOG1036|consensus | 323 | 90.84 | ||
| KOG0283|consensus | 712 | 90.28 | ||
| KOG0273|consensus | 524 | 89.82 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 89.59 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 87.68 | |
| KOG0284|consensus | 464 | 87.48 | ||
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 87.26 | |
| KOG2445|consensus | 361 | 86.88 | ||
| KOG1407|consensus | 313 | 86.79 | ||
| KOG0271|consensus | 480 | 85.59 | ||
| smart00461 | 106 | WH1 WASP homology region 1. Region of the Wiskott- | 85.42 | |
| KOG0280|consensus | 339 | 84.82 | ||
| KOG2445|consensus | 361 | 84.7 | ||
| KOG2048|consensus | 691 | 84.56 | ||
| KOG0281|consensus | 499 | 84.17 | ||
| KOG0289|consensus | 506 | 83.95 | ||
| KOG0274|consensus | 537 | 83.7 | ||
| KOG0263|consensus | 707 | 83.66 | ||
| KOG0973|consensus | 942 | 83.6 | ||
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 83.41 | |
| KOG0772|consensus | 641 | 82.64 | ||
| KOG1408|consensus | 1080 | 82.57 | ||
| KOG0316|consensus | 307 | 82.48 | ||
| KOG0275|consensus | 508 | 82.33 | ||
| KOG0273|consensus | 524 | 81.95 | ||
| KOG0299|consensus | 479 | 81.92 | ||
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 81.61 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 81.58 | |
| KOG0290|consensus | 364 | 81.42 | ||
| KOG0646|consensus | 476 | 81.39 | ||
| KOG0264|consensus | 422 | 80.02 |
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
Probab=97.80 E-value=0.00012 Score=53.82 Aligned_cols=67 Identities=21% Similarity=0.565 Sum_probs=49.8
Q ss_pred cceeeeeeecCCccEEEE-ccccCCcccEEEEEecCCceeEEEEecccCceeeeecCCCCCCCceEEEeec---CceEEe
Q psy9278 22 YQLFDCKWMPCSAKFIVL-GMKPKGTGSIQMYEINDGQPELVKTVEKPNAFKCGTFNASPLSERYLATGDF---EGKLQI 97 (98)
Q Consensus 22 yT~fD~kWIP~SArfV~l-G~~prgtG~iqIyeL~~~~l~~~~e~e~~~~~KC~TFgaSsl~~r~lAtGdf---~G~L~i 97 (98)
-.+.|+.|=|.+.+|+++ |..|+ .+++|+++ .+.+.++.+ ....+..|-.. .+.||+|+| +|.|.+
T Consensus 60 ~~I~~~~WsP~g~~favi~g~~~~---~v~lyd~~---~~~i~~~~~-~~~n~i~wsP~---G~~l~~~g~~n~~G~l~~ 129 (194)
T PF08662_consen 60 GPIHDVAWSPNGNEFAVIYGSMPA---KVTLYDVK---GKKIFSFGT-QPRNTISWSPD---GRFLVLAGFGNLNGDLEF 129 (194)
T ss_pred CceEEEEECcCCCEEEEEEccCCc---ccEEEcCc---ccEeEeecC-CCceEEEECCC---CCEEEEEEccCCCcEEEE
Confidence 359999999999999766 87776 99999996 555666643 44556666433 578888765 577998
Q ss_pred C
Q psy9278 98 W 98 (98)
Q Consensus 98 w 98 (98)
|
T Consensus 130 w 130 (194)
T PF08662_consen 130 W 130 (194)
T ss_pred E
Confidence 8
|
|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0321|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0296|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >KOG0294|consensus | Back alignment and domain information |
|---|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >KOG2055|consensus | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >KOG2106|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >smart00461 WH1 WASP homology region 1 | Back alignment and domain information |
|---|
| >KOG0280|consensus | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >KOG2048|consensus | Back alignment and domain information |
|---|
| >KOG0281|consensus | Back alignment and domain information |
|---|
| >KOG0289|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >KOG0263|consensus | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >KOG1408|consensus | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >KOG0299|consensus | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0290|consensus | Back alignment and domain information |
|---|
| >KOG0646|consensus | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 98 | ||||
| 3i2n_A | 357 | Crystal Structure Of Wd40 Repeats Protein Wdr92 Len | 1e-27 |
| >pdb|3I2N|A Chain A, Crystal Structure Of Wd40 Repeats Protein Wdr92 Length = 357 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 98 | |||
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 1e-26 |
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
Score = 99.4 bits (248), Expect = 1e-26
Identities = 50/93 (53%), Positives = 66/93 (70%)
Query: 6 KLDKPQIICLVEKSLDYQLFDCKWMPCSAKFIVLGMKPKGTGSIQMYEINDGQPELVKTV 65
+KPQII ++K +Y +FDCKW+PCSAKF+ +G +GTG IQ+YEI G +L++ +
Sbjct: 3 AFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREI 62
Query: 66 EKPNAFKCGTFNASPLSERYLATGDFEGKLQIW 98
EK KCGTF A+ L +RYLATGDF G L IW
Sbjct: 63 EKAKPIKCGTFGATSLQQRYLATGDFGGNLHIW 95
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 98 | |||
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.52 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 98.14 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 98.12 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 98.1 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 98.09 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 98.05 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 98.01 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 98.01 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 98.0 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 97.99 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 97.98 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 97.96 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 97.96 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 97.96 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 97.93 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 97.9 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 97.9 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 97.9 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 97.87 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 97.86 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 97.84 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 97.84 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 97.83 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 97.81 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 97.8 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 97.8 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 97.8 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 97.78 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 97.77 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 97.76 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 97.76 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 97.76 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 97.74 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 97.73 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 97.73 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 97.72 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 97.72 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 97.71 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 97.71 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 97.71 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 97.7 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 97.69 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 97.69 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 97.66 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 97.66 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 97.66 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 97.66 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 97.66 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 97.65 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 97.64 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 97.63 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 97.6 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 97.6 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 97.6 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 97.59 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 97.59 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 97.58 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 97.58 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 97.56 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 97.56 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 97.52 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 97.52 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 97.51 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.47 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 97.47 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 97.47 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 97.44 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 97.44 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 97.43 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 97.43 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 97.42 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.42 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 97.41 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 97.41 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 97.4 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 97.4 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 97.39 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 97.35 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 97.35 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 97.33 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 97.33 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 97.32 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 97.31 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 97.31 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 97.28 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.28 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 97.27 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 97.26 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 97.26 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 97.24 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 97.23 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.23 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 97.22 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 97.21 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 97.19 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 97.19 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 97.18 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 97.18 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 97.16 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 97.14 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 97.13 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 97.13 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 97.12 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 97.11 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 97.07 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 97.06 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 97.04 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 96.99 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 96.95 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 96.86 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.81 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 96.74 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 96.68 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 96.62 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 96.62 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 96.59 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 96.39 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 96.28 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 96.11 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.09 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 96.02 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 95.92 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 95.89 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 95.78 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 95.68 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 95.64 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 95.32 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 95.23 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 95.21 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 95.2 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 95.19 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 95.18 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 95.1 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 95.02 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 94.06 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 94.05 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 93.96 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 93.96 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 93.62 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 93.43 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 93.25 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 92.98 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 92.03 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 91.84 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 91.83 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 91.69 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 91.57 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 90.9 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 90.9 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 90.55 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 90.47 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 89.81 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 89.73 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 89.61 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 89.58 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 89.17 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 88.39 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 86.55 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 85.79 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 84.88 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 83.89 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 82.95 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 82.38 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 82.29 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 81.21 |
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.52 E-value=6.4e-14 Score=98.70 Aligned_cols=93 Identities=54% Similarity=1.116 Sum_probs=84.4
Q ss_pred CCCccceehhhhhcCCcceeeeeeecCCccEEEEccccCCcccEEEEEecCCceeEEEEecccCceeeeecCCCCCCCce
Q psy9278 6 KLDKPQIICLVEKSLDYQLFDCKWMPCSAKFIVLGMKPKGTGSIQMYEINDGQPELVKTVEKPNAFKCGTFNASPLSERY 85 (98)
Q Consensus 6 ~~~kPQIIehi~ksl~yT~fD~kWIP~SArfV~lG~~prgtG~iqIyeL~~~~l~~~~e~e~~~~~KC~TFgaSsl~~r~ 85 (98)
.+++||+++|+.+..+..+++++|-|...++++.|+..++.|.|+||+++.+++..+...++..++.|..|-..+...+.
T Consensus 3 ~~~~~~~~~~~~~~h~~~v~~~~~~p~~~~l~~~~s~~~~d~~v~iw~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~ 82 (357)
T 3i2n_A 3 AFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKCGTFGATSLQQRY 82 (357)
T ss_dssp --CCCCEEEEEEEECSSCEEEEEECTTSSEEEEEEC--CCCEEEEEEEECSSSEEEEEEEEESSCEEEEECTTCCTTTCC
T ss_pred ccChhHHhhhhccCCCCceEEEEEcCCCceEEEecCccCCCcEEEEEeCCCCcccceeeecccCcEEEEEEcCCCCCCce
Confidence 47899999999999999999999999999999999999999999999999999998988899999999999887666789
Q ss_pred EEEeecCceEEeC
Q psy9278 86 LATGDFEGKLQIW 98 (98)
Q Consensus 86 lAtGdf~G~L~iw 98 (98)
||+|+.||.+.||
T Consensus 83 l~~~~~dg~i~iw 95 (357)
T 3i2n_A 83 LATGDFGGNLHIW 95 (357)
T ss_dssp EEEEETTSCEEEE
T ss_pred EEEecCCCeEEEE
Confidence 9999999999998
|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 98 | |||
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 98.67 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 98.12 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 98.05 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 98.0 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 98.0 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 97.95 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 97.94 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 97.73 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 97.73 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 97.64 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 97.62 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 97.6 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 97.53 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 97.51 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 97.49 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 97.49 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 97.44 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 97.42 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 97.4 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 97.21 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 97.17 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 96.91 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 96.79 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 96.66 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 96.61 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 96.54 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 96.48 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 96.26 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 95.86 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 95.78 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 95.07 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 94.96 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 94.48 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 94.45 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 94.42 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 93.23 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 93.17 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 92.09 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 91.96 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 90.07 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 88.72 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 82.66 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 80.15 |
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: Cell cycle arrest protein BUB3 domain: Cell cycle arrest protein BUB3 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=98.67 E-value=6.1e-08 Score=63.65 Aligned_cols=81 Identities=17% Similarity=0.345 Sum_probs=62.3
Q ss_pred ceehhhhhcCCcceeeeeeecCCccEEEEccccCCcccEEEEEecCCc--eeEEEEecccCceeeeecCCCCCCCceEEE
Q psy9278 11 QIICLVEKSLDYQLFDCKWMPCSAKFIVLGMKPKGTGSIQMYEINDGQ--PELVKTVEKPNAFKCGTFNASPLSERYLAT 88 (98)
Q Consensus 11 QIIehi~ksl~yT~fD~kWIP~SArfV~lG~~prgtG~iqIyeL~~~~--l~~~~e~e~~~~~KC~TFgaSsl~~r~lAt 88 (98)
|+|+ |.+.-.=++.+++|-|.... ++.|+ ..|.|+||+++.++ .++....++..++.|..|-..+ ...||+
T Consensus 2 ~~v~-~~~~h~d~I~~l~fsp~~~~-L~s~s---~Dg~v~iwd~~~~~~~~~~~~~~~h~~~V~~v~f~~~~--~~~l~s 74 (342)
T d1yfqa_ 2 QIVQ-IEQAPKDYISDIKIIPSKSL-LLITS---WDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNT--DLQIYV 74 (342)
T ss_dssp EEEE-CSSCCSSCEEEEEEEGGGTE-EEEEE---TTSEEEEEEEETTTTEEEEEEEEECSSCEEEEEEEESS--SEEEEE
T ss_pred CeEE-cCCCCCCCEEEEEEeCCCCE-EEEEE---CCCeEEEEEccCCCcceEEEEecCCCCCEEEEEEeCCC--CCEEEE
Confidence 4455 55555668999999997654 55554 47899999997664 4566667789999999995543 568999
Q ss_pred eecCceEEeC
Q psy9278 89 GDFEGKLQIW 98 (98)
Q Consensus 89 Gdf~G~L~iw 98 (98)
|+.||.+.+|
T Consensus 75 g~~d~~v~~w 84 (342)
T d1yfqa_ 75 GTVQGEILKV 84 (342)
T ss_dssp EETTSCEEEE
T ss_pred cccccceeee
Confidence 9999999987
|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|