Diaphorina citri psyllid: psy9306


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MITPPKEHYGVDITPLSYIAGGKIERYLGNLNFFFIRESNCIRESGGLSGFVHSFVTEVLAILRAHVTALGGNAMVSYTMTHCILLNNQGKNQVKELF
cccccccccEEEEECcccccccEEEEEEEEEEEEEEEEECcCCccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEccccccEEEcc
*******HYGVDITPLSYIAGGKIERYLGNLNFFFIRESNCIRESGGLSGFVHSFVTEVLAILRAHVTALGGNAMVSYTMTHCILLNNQGK**VKELF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITPPKEHYGVDITPLSYIAGGKIERYLGNLNFFFIRESNCIRESGGLSGFVHSFVTEVLAILRAHVTALGGNAMVSYTMTHCILLNNQGKNQVKELF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
C2 domain-containing protein 5 confidentQ28BX9
C2 domain-containing protein 5 confidentQ7TPS5
C2 domain-containing protein 5 confidentQ5RDC8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005544 [MF]calcium-dependent phospholipid bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0031340 [BP]positive regulation of vesicle fusionprobableGO:0031338, GO:0051130, GO:0032879, GO:0051050, GO:0051049, GO:0033043, GO:0010638, GO:0060627, GO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0065002 [BP]intracellular protein transmembrane transportprobableGO:0033036, GO:0006810, GO:0071806, GO:0046907, GO:0070727, GO:0006886, GO:0034613, GO:0051179, GO:0045184, GO:0044765, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0051649, GO:0051641
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0030659 [CC]cytoplasmic vesicle membraneprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0032869 [BP]cellular response to insulin stimulusprobableGO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0032587 [CC]ruffle membraneprobableGO:0001726, GO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0044464, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0090314 [BP]positive regulation of protein targeting to membraneprobableGO:0033157, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0051050, GO:0090313, GO:0051049, GO:0032386, GO:0090316, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0051222, GO:0051223, GO:0050789, GO:0032880

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JZ7, chain A
Confidence level:confident
Coverage over the Query: 10-36,55-83
View the alignment between query and template
View the model in PyMOL
Template: 1Y2I, chain A
Confidence level:probable
Coverage over the Query: 12-86
View the alignment between query and template
View the model in PyMOL