Diaphorina citri psyllid: psy930


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MIPKSGGDYAYINEAFGPLPAFLYMWVALFVIMPTGNAVTALTFAQYILQPIWPHCDPPYSAVRLLAAVITCLLTAINCYNKYHLTCSV
cccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccc
MIPKSGGDYAYINEAFGPLPAFLYMWVALFVIMPTGNAVTALTFAQYILQPIWPHCDPPYSAVRLLAAVITCLLTAINCYNKYHLTCSV
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIPKSGGDYAYINEAFGPLPAFLYMWVALFVIMPTGNAVTALTFAQYILQPIWPHCDPPYSAVRLLAAVITCLLTAINCYNKYHLTCSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Y+L amino acid transporter 2 Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires co-expression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Also acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Involved in the transport of L-arginine in monocytes. Reduces uptake of ornithine in retinal pigment epithelial (RPE) cells.confidentQ92536
Y+L amino acid transporter 2 Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires co-expression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Also acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis via transport of L-arginine. Involved in the transport of L-arginine in monocytes. Reduces uptake of ornithine in retinal pigment epithelial cells.confidentQ8BGK6
Y+L amino acid transporter 2 Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids.confidentQ28I80

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007596 [BP]blood coagulationprobableGO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0015101 [MF]organic cation transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0008324, GO:0015075, GO:0022857, GO:0003674
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0019534 [MF]toxin transporter activityprobableGO:0005215, GO:0003674
GO:0005488 [MF]bindingprobableGO:0003674
GO:0015823 [BP]phenylalanine transportprobableGO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0044765, GO:0008150, GO:0015801, GO:0015849, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0003333 [BP]amino acid transmembrane transportprobableGO:0006810, GO:0006820, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0051179, GO:0071705, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699, GO:0046942
GO:0060356 [BP]leucine importprobableGO:0071705, GO:0006810, GO:0043090, GO:0044765, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0051179, GO:0015804, GO:0015820, GO:0008150, GO:0071702, GO:0015849, GO:0015803, GO:0051234, GO:0006820, GO:0044699, GO:0046942
GO:0015807 [BP]L-amino acid transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015196 [MF]L-tryptophan transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0003674, GO:0015179, GO:0015171, GO:0046943, GO:0015173
GO:0015192 [MF]L-phenylalanine transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0003674, GO:0015179, GO:0015171, GO:0046943, GO:0015173
GO:0015190 [MF]L-leucine transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0015658, GO:0015075, GO:0022857, GO:0003674, GO:0015179, GO:0015175, GO:0015171, GO:0046943
GO:0050900 [BP]leukocyte migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0002376, GO:0051674, GO:0008150, GO:0044763, GO:0016477, GO:0051179, GO:0044699
GO:0006520 [BP]cellular amino acid metabolic processprobableGO:0044238, GO:0044710, GO:1901564, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0015695 [BP]organic cation transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0032329 [BP]serine transportprobableGO:0071705, GO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0015804, GO:0044765, GO:0008150, GO:0015849, GO:0051234, GO:0051179, GO:0044699, GO:0046942

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DJK, chain A
Confidence level:confident
Coverage over the Query: 1-88
View the alignment between query and template
View the model in PyMOL