Diaphorina citri psyllid: psy9332


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MRLLKQIISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKADGGAAGGEALNLGNFQLLLDEEYDENNVKQNISKHNPNRWK
cHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccEEEECccccCEEEEEccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccHHHHHHHccccccccc
MRLLK**ISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKADGGAAGGEALNLGNFQLLLDE********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLLKQIISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKADGGAAGGEALNLGNFQLLLDEEYDENNVKQNISKHNPNRWK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable tubulin polyglutamylase TTLL1 Catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin.confidentO95922
Probable tubulin polyglutamylase TTLL1 Catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin.confidentQ0VC71
Probable tubulin polyglutamylase TTLL1 Catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin.confidentQ91V51

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005929 [CC]ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0070740 [MF]tubulin-glutamic acid ligase activityprobableGO:0003824, GO:0070739, GO:0016881, GO:0016879, GO:0003674, GO:0016874
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0018095 [BP]protein polyglutamylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0018200, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TIG, chain A
Confidence level:very confident
Coverage over the Query: 1-108
View the alignment between query and template
View the model in PyMOL