Psyllid ID: psy9332

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MRLLKQIISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKADGGAAGGEALNLGNFQLLLDEEYDENNVKQNISKHNPNRWK
cHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccEEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccHHHHHHHccccccccc
ccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHEEEEccEEEEccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHccccccccccHHcccccHHHccccEEEEcHHHHHHcHHHHHHHccccccc
MRLLKQIIShssqvyprgkditnKLFTNISWLIVHSLKSVSYIMANDkhcfecygydiiidnqlkpwlievnaspsltcttvndRILKYKLIDNILNIVMWnkykkadggaaggealnlGNFQLLLDeeydennvkqniskhnpnrwk
mrllkqiishssqvyprgkdiTNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKADGGAAGGEALNLGNFQLLLDEEydennvkqniskhnpnrwk
MRLLKQIISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKadggaaggeaLNLGNFQLLLDEEYDENNVKQNISKHNPNRWK
*************VYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKADGGAAGGEALNLGNFQLLLDE********************
MRLLK**ISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNK***************LGNFQL************************
MRLLKQIISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKADGGAAGGEALNLGNFQLLLDEEYDENNVKQNI*********
MRLLKQIISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKADGGAAGGEALNLGNFQLLLDEEYDENNVK************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLLKQIISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRILKYKLIDNILNIVMWNKYKKADGGAAGGEALNLGNFQLLLDEEYDENNVKQNISKHNPNRWK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q0VC71423 Probable tubulin polyglut yes N/A 0.817 0.286 0.510 6e-33
Q91V51423 Probable tubulin polyglut yes N/A 0.817 0.286 0.503 1e-32
Q5PPI9423 Probable tubulin polyglut yes N/A 0.817 0.286 0.503 1e-32
O95922423 Probable tubulin polyglut yes N/A 0.702 0.245 0.573 1e-32
Q23SI8433 Probable alpha-tubulin po N/A N/A 0.743 0.254 0.508 3e-23
Q3SXZ7439 Probable tubulin polyglut no N/A 0.554 0.186 0.512 3e-18
Q3SZH6461 Probable tubulin polyglut no N/A 0.554 0.177 0.5 6e-18
Q641W7461 Probable tubulin polyglut no N/A 0.554 0.177 0.487 2e-17
A2APC3461 Probable tubulin polyglut no N/A 0.554 0.177 0.487 2e-17
Q9BWV7 592 Probable tubulin polyglut no N/A 0.668 0.167 0.317 2e-11
>sp|Q0VC71|TTLL1_BOVIN Probable tubulin polyglutamylase TTLL1 OS=Bos taurus GN=TTLL1 PE=2 SV=1 Back     alignment and function desciption
 Score =  139 bits (350), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 93/139 (66%), Gaps = 18/139 (12%)

Query: 17  RGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPS 76
           RGK++T+KLF  I W+IV SLK+V+ +M NDKHCFECYGYDIIID++LKPWLIEVNASPS
Sbjct: 273 RGKEVTSKLFDEIHWIIVQSLKAVAPVMNNDKHCFECYGYDIIIDDKLKPWLIEVNASPS 332

Query: 77  LTCTTVNDRILKYKLIDNILNIVM---------WNKYKKADGGAAGGEALNLGNFQLLLD 127
           LT +T NDRILKY LI++ LNI +         WNK    +          LGN+++L D
Sbjct: 333 LTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEV---------LGNYEILYD 383

Query: 128 EEYDENNVKQNISKHNPNR 146
           EE  + +  +   +  P +
Sbjct: 384 EELAQGDGAERELRSRPGQ 402
Catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin.
Bos taurus (taxid: 9913)
EC: 6EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q91V51|TTLL1_MOUSE Probable tubulin polyglutamylase TTLL1 OS=Mus musculus GN=Ttll1 PE=1 SV=1 Back     alignment and function description
>sp|Q5PPI9|TTLL1_RAT Probable tubulin polyglutamylase TTLL1 OS=Rattus norvegicus GN=Ttll1 PE=2 SV=1 Back     alignment and function description
>sp|O95922|TTLL1_HUMAN Probable tubulin polyglutamylase TTLL1 OS=Homo sapiens GN=TTLL1 PE=2 SV=1 Back     alignment and function description
>sp|Q23SI8|TTLL1_TETTS Probable alpha-tubulin polyglutamylase Ttll1 OS=Tetrahymena thermophila (strain SB210) GN=Ttll1 PE=3 SV=1 Back     alignment and function description
>sp|Q3SXZ7|TTLL9_HUMAN Probable tubulin polyglutamylase TTLL9 OS=Homo sapiens GN=TTLL9 PE=2 SV=3 Back     alignment and function description
>sp|Q3SZH6|TTLL9_BOVIN Probable tubulin polyglutamylase TTLL9 OS=Bos taurus GN=TTLL9 PE=2 SV=1 Back     alignment and function description
>sp|Q641W7|TTLL9_RAT Probable tubulin polyglutamylase TTLL9 OS=Rattus norvegicus GN=Ttll9 PE=2 SV=1 Back     alignment and function description
>sp|A2APC3|TTLL9_MOUSE Probable tubulin polyglutamylase TTLL9 OS=Mus musculus GN=Ttll9 PE=2 SV=2 Back     alignment and function description
>sp|Q9BWV7|TTLL2_HUMAN Probable tubulin polyglutamylase TTLL2 OS=Homo sapiens GN=TTLL2 PE=5 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
312373172 466 hypothetical protein AND_17841 [Anophele 0.831 0.263 0.609 2e-39
195428998 507 GK16596 [Drosophila willistoni] gi|19415 0.831 0.242 0.581 4e-39
195125235 498 GI12743 [Drosophila mojavensis] gi|19391 0.831 0.246 0.573 5e-39
157108872 436 hypothetical protein AaeL_AAEL005148 [Ae 0.831 0.282 0.620 5e-39
307212492 408 Probable tubulin polyglutamylase TTLL1 [ 0.831 0.301 0.604 2e-38
194747507 448 GF25086 [Drosophila ananassae] gi|190623 0.831 0.274 0.574 2e-38
195011645 488 GH15692 [Drosophila grimshawi] gi|195079 0.763 0.231 0.618 2e-38
195167958 480 GL17911 [Drosophila persimilis] gi|19410 0.763 0.235 0.618 3e-38
198463016 480 GA16777 [Drosophila pseudoobscura pseudo 0.763 0.235 0.618 3e-38
332029621 376 Putative tubulin polyglutamylase TTLL1 [ 0.702 0.276 0.663 3e-38
>gi|312373172|gb|EFR20973.1| hypothetical protein AND_17841 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/146 (60%), Positives = 106/146 (72%), Gaps = 23/146 (15%)

Query: 17  RGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPS 76
           RGK++T+KLF +I+WLIVHSLK+VS +MA+D+HCFECYGYDIIIDN LKPWL+EVNASPS
Sbjct: 330 RGKEVTDKLFGSITWLIVHSLKAVSSVMASDRHCFECYGYDIIIDNTLKPWLVEVNASPS 389

Query: 77  LTCTTVNDRILKYKLIDNILNIVM---------WNKYKKADGGAAGGEALNLGNFQLLLD 127
           LT TT NDRILKYKLIDNILNIV+         WNK    D          LGNF LL+D
Sbjct: 390 LTSTTANDRILKYKLIDNILNIVLPPDGVPDVRWNKIPSPD---------MLGNFDLLID 440

Query: 128 EE--YDENNVKQNIS---KHNPNRWK 148
           EE    E+N++ + S   + N NRWK
Sbjct: 441 EEIAAQEDNMQNSSSGKHRSNSNRWK 466

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195428998|ref|XP_002062551.1| GK16596 [Drosophila willistoni] gi|194158636|gb|EDW73537.1| GK16596 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195125235|ref|XP_002007087.1| GI12743 [Drosophila mojavensis] gi|193918696|gb|EDW17563.1| GI12743 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|157108872|ref|XP_001650424.1| hypothetical protein AaeL_AAEL005148 [Aedes aegypti] gi|108879202|gb|EAT43427.1| AAEL005148-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307212492|gb|EFN88223.1| Probable tubulin polyglutamylase TTLL1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|194747507|ref|XP_001956193.1| GF25086 [Drosophila ananassae] gi|190623475|gb|EDV38999.1| GF25086 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195011645|ref|XP_001983248.1| GH15692 [Drosophila grimshawi] gi|195079786|ref|XP_001997267.1| GH24113 [Drosophila grimshawi] gi|193891574|gb|EDV90440.1| GH24113 [Drosophila grimshawi] gi|193896730|gb|EDV95596.1| GH15692 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195167958|ref|XP_002024799.1| GL17911 [Drosophila persimilis] gi|194108229|gb|EDW30272.1| GL17911 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198463016|ref|XP_001352654.2| GA16777 [Drosophila pseudoobscura pseudoobscura] gi|198151077|gb|EAL30152.2| GA16777 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|332029621|gb|EGI69510.1| Putative tubulin polyglutamylase TTLL1 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
FB|FBgn0052238487 CG32238 [Drosophila melanogast 0.891 0.271 0.571 1.7e-36
UNIPROTKB|F1NZA9427 TTLL1 "Uncharacterized protein 0.797 0.276 0.584 2.9e-32
UNIPROTKB|Q0VC71423 TTLL1 "Probable tubulin polygl 0.878 0.307 0.530 6e-32
UNIPROTKB|F1SJR6423 TTLL1 "Uncharacterized protein 0.763 0.267 0.601 7.7e-32
MGI|MGI:2443047423 Ttll1 "tubulin tyrosine ligase 0.878 0.307 0.523 7.7e-32
UNIPROTKB|E2RTA4423 TTLL1 "Uncharacterized protein 0.763 0.267 0.601 9.8e-32
UNIPROTKB|O95922423 TTLL1 "Probable tubulin polygl 0.763 0.267 0.601 9.8e-32
RGD|1309124423 Ttll1 "tubulin tyrosine ligase 0.878 0.307 0.523 1.3e-31
UNIPROTKB|Q5PPI9423 Ttll1 "Probable tubulin polygl 0.878 0.307 0.523 1.3e-31
ZFIN|ZDB-GENE-040426-1326423 ttll1 "tubulin tyrosine ligase 0.763 0.267 0.610 1.3e-31
FB|FBgn0052238 CG32238 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 393 (143.4 bits), Expect = 1.7e-36, P = 1.7e-36
 Identities = 80/140 (57%), Positives = 101/140 (72%)

Query:    17 RGKDITNKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPS 76
             RGK++T++LF  ISWLIVHSL++V+ +MA+D+HCFECYGYDIIIDN LKPWL+EVNASPS
Sbjct:   348 RGKEVTDRLFGAISWLIVHSLRAVAPVMASDRHCFECYGYDIIIDNALKPWLVEVNASPS 407

Query:    77 LTCTTVNDRILKYKLIDNILNIVMWNKYKKXXXXXXXXXXLNLGNFQLLLDEEY---DEN 133
             LT TTVNDRILKYKLIDNIL++V+                  LGNF+LL+DEE    DE 
Sbjct:   408 LTSTTVNDRILKYKLIDNILSVVLPPDGVPDVRWNKVPSADALGNFELLIDEELAAQDEQ 467

Query:   134 NVKQNISKHNP-----NRWK 148
             +   + + H+      +RWK
Sbjct:   468 HQNSSSNTHSKTSKMGSRWK 487
GO:0004835 "tubulin-tyrosine ligase activity" evidence=ISS
GO:0018166 "C-terminal protein-tyrosinylation" evidence=ISS
UNIPROTKB|F1NZA9 TTLL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VC71 TTLL1 "Probable tubulin polyglutamylase TTLL1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SJR6 TTLL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2443047 Ttll1 "tubulin tyrosine ligase-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RTA4 TTLL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O95922 TTLL1 "Probable tubulin polyglutamylase TTLL1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309124 Ttll1 "tubulin tyrosine ligase-like family, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5PPI9 Ttll1 "Probable tubulin polyglutamylase TTLL1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1326 ttll1 "tubulin tyrosine ligase-like family, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O95922TTLL1_HUMAN6, ., -, ., -, ., -0.57370.70270.2458yesN/A
Q0VC71TTLL1_BOVIN6, ., -, ., -, ., -0.51070.81750.2860yesN/A
Q91V51TTLL1_MOUSE6, ., -, ., -, ., -0.50350.81750.2860yesN/A
Q5PPI9TTLL1_RAT6, ., -, ., -, ., -0.50350.81750.2860yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
pfam03133291 pfam03133, TTL, Tubulin-tyrosine ligase family 3e-24
>gnl|CDD|217380 pfam03133, TTL, Tubulin-tyrosine ligase family Back     alignment and domain information 
 Score = 94.3 bits (235), Expect = 3e-24
 Identities = 36/84 (42%), Positives = 52/84 (61%), Gaps = 1/84 (1%)

Query: 17  RGKDITNKLFTNISWLIVHSLKSVSYI-MANDKHCFECYGYDIIIDNQLKPWLIEVNASP 75
             ++I  ++ + I   I+ +    S + +    +CFE YG+D +ID  LKPWL+EVNASP
Sbjct: 199 DKEEIWLEIESIIIKTILAAEVEASRLNVQPLYNCFELYGFDFMIDENLKPWLLEVNASP 258

Query: 76  SLTCTTVNDRILKYKLIDNILNIV 99
           SL  TT  D  LK +LID++LN V
Sbjct: 259 SLHSTTKLDARLKEQLIDDVLNSV 282

Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed. This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL). The true physiological function of TTL has so far not been established. Tubulin-tyrosine ligase (TTL) catalyzes the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness. On the other hand, 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis. Bacterial homologs of TTL are predicted to form peptide tags. Some of these are fused to a 2-oxoglutarate Fe(II)-dependent dioxygenase domain. Length = 291

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
PF03133292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 99.85
KOG2156|consensus662 99.78
KOG2157|consensus497 99.77
KOG2158|consensus565 99.24
PF14398262 ATPgrasp_YheCD: YheC/D like ATP-grasp 98.93
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 98.17
PRK14570364 D-alanyl-alanine synthetase A; Provisional 98.05
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-gr 98.01
PRK14568343 vanB D-alanine--D-lactate ligase; Provisional 97.97
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 97.88
PRK14569296 D-alanyl-alanine synthetase A; Provisional 97.86
PRK14572347 D-alanyl-alanine synthetase A; Provisional 97.72
PRK14571299 D-alanyl-alanine synthetase A; Provisional 97.7
TIGR01205315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 97.64
TIGR02291317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 97.61
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 97.59
PRK14573809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 97.55
PRK10446300 ribosomal protein S6 modification protein; Provisi 97.32
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 97.22
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 96.89
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 96.86
PLN02257434 phosphoribosylamine--glycine ligase 96.6
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 96.6
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 96.59
PF14397285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 96.36
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 95.99
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 95.86
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 95.66
PLN02948 577 phosphoribosylaminoimidazole carboxylase 94.77
PLN02941328 inositol-tetrakisphosphate 1-kinase 94.57
PRK06524493 biotin carboxylase-like protein; Validated 94.44
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 94.25
TIGR00877423 purD phosphoribosylamine--glycine ligase. This enz 94.23
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 94.07
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 94.01
PRK06111450 acetyl-CoA carboxylase biotin carboxylase subunit; 93.91
PRK06849389 hypothetical protein; Provisional 93.85
TIGR00514449 accC acetyl-CoA carboxylase, biotin carboxylase su 93.8
PRK13790379 phosphoribosylamine--glycine ligase; Provisional 93.79
KOG2158|consensus 565 93.79
KOG2155|consensus631 93.78
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 93.52
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 93.4
PRK08591451 acetyl-CoA carboxylase biotin carboxylase subunit; 93.39
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 93.39
PRK00885420 phosphoribosylamine--glycine ligase; Provisional 93.14
PRK05586447 biotin carboxylase; Validated 93.14
TIGR01435737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 92.96
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 92.8
PRK08462445 biotin carboxylase; Validated 92.75
PRK07178 472 pyruvate carboxylase subunit A; Validated 92.32
PLN02735 1102 carbamoyl-phosphate synthase 92.08
PF05770307 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- 91.89
), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071194 GARS_A: Phosphoribosylglycinamide synthetase, ATP- 91.55
PRK12833467 acetyl-CoA carboxylase biotin carboxylase subunit; 91.35
PRK08463 478 acetyl-CoA carboxylase subunit A; Validated 91.31
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 91.08
PRK14016 727 cyanophycin synthetase; Provisional 90.55
PRK13278358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 90.4
PRK07206416 hypothetical protein; Provisional 89.95
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 89.8
PRK05784 486 phosphoribosylamine--glycine ligase; Provisional 88.87
TIGR02068 864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 88.57
PLN02735 1102 carbamoyl-phosphate synthase 88.39
PRK02471752 bifunctional glutamate--cysteine ligase/glutathion 87.7
PF04174 330 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; In 86.85
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 86.26
PRK08654 499 pyruvate carboxylase subunit A; Validated 85.27
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 84.0
PRK12999 1146 pyruvate carboxylase; Reviewed 83.05
PRK13277366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 81.72
PRK05246316 glutathione synthetase; Provisional 81.32
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information 
Probab=99.85  E-value=3.6e-22  Score=163.73  Aligned_cols=98  Identities=36%  Similarity=0.621  Sum_probs=75.3

Q ss_pred             CccHHHHHHHHHhhccCCcchhHHHHHHHHHHHHHHHHHc-----hhhhcCCCCcceeeeeeEEEeCCCCcEEEeeccCC
Q psy9332           1 MRLLKQIISHSSQVYPRGKDITNKLFTNISWLIVHSLKSV-----SYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASP   75 (148)
Q Consensus         1 ~~~l~q~~~~L~~~~~~G~d~~~~i~~~i~~ii~~t~~a~-----~~~l~~~~~~FEl~G~D~~iD~~~kpwLLEVN~~P   75 (148)
                      +|++.+|.+|+..    |.++ +.+|++|..++++++.++     ...+..+.+|||+||+|||||++++|||||||++|
T Consensus       186 ~~~~~~~~~~l~~----~~~~-~~~~~~i~~~i~~~~~~~~~~~~~~~~~~~~~~Fel~G~DfmlD~~~kpwLLEvN~~P  260 (292)
T PF03133_consen  186 KWSLDQFEEYLKE----GIDW-EKIWEKICDIIIKTILAAEFRSSQPNMPPRPNCFELFGFDFMLDEDLKPWLLEVNSNP  260 (292)
T ss_dssp             EHHHHHHHCTTTS----SS-S-TTTCHHHHHHHHHHHHHH-HHHHH--TTSSSEE-EEEEEEEEEBTTS-EEEEEEESS-
T ss_pred             cchhhhhhhhccc----CCCc-ccchhhhhHHHHHHhhhhhhhhccccccccccccceeeeEEEecCCCeEEEeeCCCCC
Confidence            5788999988854    5665 789999999999999888     34555678999999999999999999999999999


Q ss_pred             CCCcCCcchHHHHHHHHHHHHhhccccc
Q psy9332          76 SLTCTTVNDRILKYKLIDNILNIVMWNK  103 (148)
Q Consensus        76 ~l~~~~~~~~~lk~~ll~d~l~lv~~~~  103 (148)
                      +++.+++.+..++++|++|+++++.++.
T Consensus       261 sl~~~~~~~~~~~~~li~d~l~i~v~~~  288 (292)
T PF03133_consen  261 SLSTSTPVDKELKPQLIDDLLKIVVDPD  288 (292)
T ss_dssp             -----TTTHHHHHHHHHHHTTTTTS---
T ss_pred             CcccCCHhHHHHHHHHHHHHhEEEeCCC
Confidence            9999999999999999999999888654

This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL) []. Tubulin-tyrosine ligase (TTL) catalyses the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. The true physiological function of TTL has so far not been established. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness []. 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis [].; GO: 0004835 tubulin-tyrosine ligase activity, 0006464 protein modification process; PDB: 3TII_A 3TIN_A 3TIG_A.
>KOG2156|consensus Back     alignment and domain information
>KOG2157|consensus Back     alignment and domain information
>KOG2158|consensus Back     alignment and domain information
>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>KOG2158|consensus Back     alignment and domain information
>KOG2155|consensus Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase Back     alignment and domain information
>PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>PF04174 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; InterPro: IPR007302 This is a domain of unknown function Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3tig_A380 Tubulin Tyrosine Ligase Length = 380 3e-04
4i4t_F384 Crystal Structure Of Tubulin-rb3-ttl-zampanolide Co 7e-04
>pdb|3TIG|A Chain A, Tubulin Tyrosine Ligase Length = 380 Back     alignment and structure 
Iteration: 1

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%)
Query: 49  HCFECYGYDIIIDNQLKPWLIEVNASPS 76
           H F+ +G+D ++D  LK WLIEVN +P+
Sbjct: 313 HSFQLFGFDFMVDKNLKVWLIEVNGAPA 340
>pdb|4I4T|F Chain F, Crystal Structure Of Tubulin-rb3-ttl-zampanolide Complex Length = 384 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 9e-19
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Length = 380 Back     alignment and structure
 Score = 80.0 bits (197), Expect = 9e-19
 Identities = 21/93 (22%), Positives = 41/93 (44%), Gaps = 5/93 (5%)

Query: 17  RGKDITNKLFTNISWLIVHSLKSVSYIMANDK---HCFECYGYDIIIDNQLKPWLIEVNA 73
              ++ N +   I  +I   L  +   ++      H F+ +G+D ++D  LK WLIEVN 
Sbjct: 278 LNINLENSILCQIKEIIRVCLSCLEPAISTKYLPYHSFQLFGFDFMVDKNLKVWLIEVNG 337

Query: 74  SPSLTCTTVNDRILKYKLIDNILNIVMWNKYKK 106
           +P+       +  L   ++D  ++ V     + 
Sbjct: 338 APACAQKLYAE--LCKGIVDLAISSVFPLNEEN 368

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 99.85
4fu0_A357 D-alanine--D-alanine ligase 7; vancomycin resistan 98.36
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 98.02
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 97.98
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 97.97
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 97.92
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 97.92
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 97.92
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 97.91
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 97.86
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 97.76
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 97.74
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 97.71
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 97.63
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 97.61
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 97.55
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kina 97.52
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 97.29
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 97.06
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.04
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 96.9
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 96.52
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.48
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 96.36
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 96.33
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 96.15
3vot_A425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 96.08
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.01
3aw8_A369 PURK, phosphoribosylaminoimidazole carboxylase, AT 95.96
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 95.92
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin car 95.87
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 95.85
1vkz_A412 Phosphoribosylamine--glycine ligase; TM1250, struc 95.8
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 95.73
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 95.56
3mjf_A431 Phosphoribosylamine--glycine ligase; structural ge 95.52
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 95.49
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 95.22
3ouz_A446 Biotin carboxylase; structural genomics, center fo 95.15
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 95.02
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 94.88
2xcl_A422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 94.84
2ip4_A417 PURD, phosphoribosylamine--glycine ligase; GAR syn 94.83
2yw2_A424 Phosphoribosylamine--glycine ligase; glycinamide r 94.78
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 94.63
2yrx_A451 Phosphoribosylglycinamide synthetase; glycinamide 94.53
3lp8_A442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 94.51
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 94.51
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 94.38
2qk4_A452 Trifunctional purine biosynthetic protein adenosi; 94.25
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 94.15
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 93.64
3ln7_A757 Glutathione biosynthesis bifunctional protein GSH; 93.34
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 93.22
3vmm_A474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 93.21
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 93.08
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 92.22
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 92.08
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 91.49
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 91.43
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 90.59
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 89.41
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 87.39
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 86.95
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 86.81
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 86.09
3t7a_A330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 80.74
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
Probab=99.85  E-value=2.3e-21  Score=165.11  Aligned_cols=100  Identities=21%  Similarity=0.416  Sum_probs=89.7

Q ss_pred             CccHHHHHHHHHhhccCCcchhHHHHHHHHHHHHHHHHHchhhhcCC---CCcceeeeeeEEEeCCCCcEEEeeccCCCC
Q psy9332           1 MRLLKQIISHSSQVYPRGKDITNKLFTNISWLIVHSLKSVSYIMAND---KHCFECYGYDIIIDNQLKPWLIEVNASPSL   77 (148)
Q Consensus         1 ~~~l~q~~~~L~~~~~~G~d~~~~i~~~i~~ii~~t~~a~~~~l~~~---~~~FEl~G~D~~iD~~~kpwLLEVN~~P~l   77 (148)
                      +|++++|.+||.+.+  |.++.+.||++|++++++++.|+++.+...   .+|||+||+|||||++++|||||||++|++
T Consensus       264 ~~~~~~f~~yL~~~~--~~~~~~~i~~~I~~ii~~~l~a~~~~i~~~~~~~~~FEl~G~D~lid~~l~~wllEVN~~P~~  341 (380)
T 3tig_A          264 EMFFEEFNQYLVTSL--NINLENSILCQIKEIIRVCLSCLEPAISTKYLPYHSFQLFGFDFMVDKNLKVWLIEVNGAPAC  341 (380)
T ss_dssp             CBCHHHHHHHHSTTS--SCCHHHHTHHHHHHHHHHHHHHHHHHHCCTTSSSEECEEEEEEEEEBTTCCEEEEEEESSCCC
T ss_pred             cCcHHHHHHHHHHhc--CccHHHHHHHHHHHHHHHHHHHHHHHhhhcccCCceEEEEeEEEEEcCCCcEEEEEEeCCCCc
Confidence            488999999997643  777777999999999999999999988753   589999999999999999999999999999


Q ss_pred             CcCCcchHHHHHHHHHHHHhhcccccCCCCC
Q psy9332          78 TCTTVNDRILKYKLIDNILNIVMWNKYKKAD  108 (148)
Q Consensus        78 ~~~~~~~~~lk~~ll~d~l~lv~~~~~~~~~  108 (148)
                      ..      .+.++|+++++++++++-++++.
T Consensus       342 ~q------~~i~~l~~~~~~iavdp~f~~~~  366 (380)
T 3tig_A          342 AQ------KLYAELCKGIVDLAISSVFPLNE  366 (380)
T ss_dssp             CT------TTHHHHHHHHHHHTTTTTSCCCC
T ss_pred             cH------HhHHHHHHHHHHHhcccccCCcc
Confidence            74      38899999999999999999873
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1e4ea2211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 98.4
d1ehia2228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 98.17
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 98.03
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 97.63
d1vkza3220 Glycinamide ribonucleotide synthetase (GAR-syn), d 97.23
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 96.59
d2r7ka2238 5-formaminoimidazole-4-carboxamide ribonucleotide 96.42
d1gsoa3224 Glycinamide ribonucleotide synthetase (GAR-syn), d 96.38
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 96.25
d2r85a2235 5-formaminoimidazole-4-carboxamide ribonucleotide 96.15
d1w96a3267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 95.31
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 94.0
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 92.25
d3etja3198 N5-carboxyaminoimidazole ribonucleotide synthetase 90.91
d1a9xa6259 Carbamoyl phosphate synthetase (CPS), large subuni 90.77
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: ATP-binding domain of peptide synthetases
domain: D-alanine:D-lactate ligase VanA, C-domain
species: Enterococcus faecium [TaxId: 1352]

Probab=98.40  E-value=8e-07  Score=65.43  Aligned_cols=69  Identities=20%  Similarity=0.250  Sum_probs=52.4

Q ss_pred             HHHHHHHHHHHHHHHHHchhhhcCCCCcceeeeeeEEEeCCCCcEEEeeccCCCCCcCCcchHHH------HHHHHHHHH
Q psy9332          23 NKLFTNISWLIVHSLKSVSYIMANDKHCFECYGYDIIIDNQLKPWLIEVNASPSLTCTTVNDRIL------KYKLIDNIL   96 (148)
Q Consensus        23 ~~i~~~i~~ii~~t~~a~~~~l~~~~~~FEl~G~D~~iD~~~kpwLLEVN~~P~l~~~~~~~~~l------k~~ll~d~l   96 (148)
                      +.+..++++++.+++.+.        ++....++||++|.++++|++|||+.|++...+.+....      .++|++.++
T Consensus       135 ~~~~~~i~~~a~~~~~~l--------g~~g~~~id~~~~~~g~~~viEiN~~pg~~~~s~~~~~~~~~G~~~~~li~~iv  206 (211)
T d1e4ea2         135 AEERGRIQETVKKIYKTL--------GCRGLARVDMFLQDNGRIVLNEVNTLPGFTSYSRYPRMMAAAGISLPELIDRLI  206 (211)
T ss_dssp             HHHHHHHHHHHHHHHHHT--------TCEEEEEEEEEECTTCCEEEEEEESSCCCSTTCHHHHHHHHTTCCHHHHHHHHH
T ss_pred             HhhhhhhHHHHHHHHHhh--------ccCCeeEEEEEEcCCCCEEEEEEeCCCCCCCccHHHHHHHHcCCCHHHHHHHHH
Confidence            567778888888776654        345678999999999999999999999998877554432      246677666


Q ss_pred             hhc
Q psy9332          97 NIV   99 (148)
Q Consensus        97 ~lv   99 (148)
                      ++.
T Consensus       207 ~~a  209 (211)
T d1e4ea2         207 VLA  209 (211)
T ss_dssp             HHH
T ss_pred             HHH
Confidence            654
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure