Diaphorina citri psyllid: psy9334


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
MPCRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS
ccccccHHHHHHHHHHHcccccccEEEEEHHHHHHHHccccccEEEcccccHHHHHHHHHHcccc
*PCRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPCRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial Performs an essential role in the oxidative function of the citric acid cycle. Also binds RNA; specifically to the 5'-untranslated leaders of mitochondrial mRNAs.confidentO13696
Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial confidentQ5RBT4
Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial confidentQ68FX0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0004449 [MF]isocitrate dehydrogenase (NAD+) activityprobableGO:0016614, GO:0016616, GO:0003824, GO:0003674, GO:0004448, GO:0016491
GO:0006099 [BP]tricarboxylic acid cycleprobableGO:0044238, GO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0009060, GO:0008150, GO:0008152, GO:0045333, GO:0006091, GO:0055114
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0006103 [BP]2-oxoglutarate metabolic processprobableGO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0006102 [BP]isocitrate metabolic processprobableGO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:0072350
GO:0006734 [BP]NADH metabolic processprobableGO:0019674, GO:0006732, GO:0006733, GO:0034641, GO:0006807, GO:0044281, GO:0072524, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0071704, GO:0009987, GO:0006793, GO:0006725, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0044237, GO:0006796, GO:0019362, GO:0019637, GO:0008150, GO:0006753, GO:0046496
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0051287 [MF]NAD bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UDU, chain A
Confidence level:very confident
Coverage over the Query: 3-65
View the alignment between query and template
View the model in PyMOL