Psyllid ID: psy9334

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-----
MPCRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS
ccccccHHHHHHHHHHHcccccccEEEEEHHHHHHHHccccccEEEcccccHHHHHHHHHHcccc
ccHHHHHHHHHHHHHccccccEEEEEEHHHHHHHHHHcHHHccEEEEcHHHHHHHHHHHHHHHcc
mpcrfgypnlgqTMAKLYPKIqfeqmivdnctmqivsnphqfdvmvmpnlyGNIVDNLASDIKGS
mpcrfgypnlgQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS
MPCRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS
****FGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNL*******
*PCRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS
MPCRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS
MPCRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPCRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query65 2.2.26 [Sep-21-2011]
O77784385 Isocitrate dehydrogenase yes N/A 0.815 0.137 0.679 2e-18
Q68FX0385 Isocitrate dehydrogenase yes N/A 0.815 0.137 0.679 4e-18
O43837385 Isocitrate dehydrogenase yes N/A 0.815 0.137 0.679 4e-18
Q5RBT4385 Isocitrate dehydrogenase yes N/A 0.815 0.137 0.679 4e-18
Q28479385 Isocitrate dehydrogenase N/A N/A 0.815 0.137 0.679 5e-18
Q93353379 Probable isocitrate dehyd yes N/A 0.815 0.139 0.698 4e-17
Q58CP0 392 Isocitrate dehydrogenase no N/A 0.815 0.135 0.641 1e-14
P51553 393 Isocitrate dehydrogenase no N/A 0.815 0.134 0.641 2e-14
P41564 355 Isocitrate dehydrogenase N/A N/A 0.815 0.149 0.641 3e-14
P41565 393 Isocitrate dehydrogenase no N/A 0.815 0.134 0.622 5e-14
>sp|O77784|IDH3B_BOVIN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Bos taurus GN=IDH3B PE=2 SV=2 Back     alignment and function desciption
 Score = 90.9 bits (224), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/53 (67%), Positives = 48/53 (90%)

Query: 12  QTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKG 64
           + +A+LYPKI+FE+MI+DNC MQ+V NP+QFDV+VMPNLYGNI+DNLA+ + G
Sbjct: 234 EEVAELYPKIKFEKMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVG 286

Bos taurus (taxid: 9913)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q68FX0|IDH3B_RAT Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Rattus norvegicus GN=Idh3B PE=1 SV=1 Back     alignment and function description
>sp|O43837|IDH3B_HUMAN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens GN=IDH3B PE=1 SV=2 Back     alignment and function description
>sp|Q5RBT4|IDH3B_PONAB Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Pongo abelii GN=IDH3B PE=2 SV=1 Back     alignment and function description
>sp|Q28479|IDH3B_MACFA Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Macaca fascicularis GN=IDH3B PE=2 SV=2 Back     alignment and function description
>sp|Q93353|IDH3B_CAEEL Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=C37E2.1 PE=3 SV=1 Back     alignment and function description
>sp|Q58CP0|IDH3G_BOVIN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Bos taurus GN=IDH3G PE=2 SV=1 Back     alignment and function description
>sp|P51553|IDH3G_HUMAN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens GN=IDH3G PE=1 SV=1 Back     alignment and function description
>sp|P41564|IDH3G_MACFA Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (Fragment) OS=Macaca fascicularis GN=IDH3G PE=2 SV=1 Back     alignment and function description
>sp|P41565|IDHG1_RAT Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus GN=Idh3g PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
332023734 374 Isocitrate dehydrogenase [NAD] subunit b 0.784 0.136 0.843 7e-19
345491738 373 PREDICTED: probable isocitrate dehydroge 0.784 0.136 0.843 9e-19
307166534 374 Probable isocitrate dehydrogenase [NAD] 0.784 0.136 0.823 1e-18
307210578 374 Probable isocitrate dehydrogenase [NAD] 0.784 0.136 0.823 1e-18
322793633 375 hypothetical protein SINV_09716 [Solenop 0.784 0.136 0.823 2e-18
357604218 369 hypothetical protein KGM_01993 [Danaus p 0.784 0.138 0.823 3e-18
66530240 374 PREDICTED: isocitrate dehydrogenase [NAD 0.784 0.136 0.784 7e-18
380026705 374 PREDICTED: isocitrate dehydrogenase [NAD 0.784 0.136 0.784 7e-18
383856749 374 PREDICTED: isocitrate dehydrogenase [NAD 0.753 0.131 0.816 1e-17
340708564 374 PREDICTED: isocitrate dehydrogenase [NAD 0.784 0.136 0.764 2e-17
>gi|332023734|gb|EGI63958.1| Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score = 97.8 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 43/51 (84%), Positives = 47/51 (92%)

Query: 12  QTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDI 62
           Q +AKLYP+I FE MIVDNCTMQ+VSNPHQFDVMVMPNLYGNIVDNLAS +
Sbjct: 227 QEIAKLYPRITFETMIVDNCTMQMVSNPHQFDVMVMPNLYGNIVDNLASGL 277

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|345491738|ref|XP_001607423.2| PREDICTED: probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307166534|gb|EFN60601.1| Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307210578|gb|EFN87046.1| Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322793633|gb|EFZ17083.1| hypothetical protein SINV_09716 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|357604218|gb|EHJ64090.1| hypothetical protein KGM_01993 [Danaus plexippus] Back     alignment and taxonomy information
>gi|66530240|ref|XP_624511.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380026705|ref|XP_003697085.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|383856749|ref|XP_003703870.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340708564|ref|XP_003392893.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
UNIPROTKB|I3L8X0312 LOC100624447 "Uncharacterized 0.815 0.169 0.679 5.3e-17
UNIPROTKB|O77784385 IDH3B "Isocitrate dehydrogenas 0.815 0.137 0.679 9.5e-17
UNIPROTKB|F1PTM3383 IDH3B "Uncharacterized protein 0.815 0.138 0.679 1.6e-16
UNIPROTKB|E2QUB9385 IDH3B "Uncharacterized protein 0.815 0.137 0.679 1.6e-16
UNIPROTKB|O43837385 IDH3B "Isocitrate dehydrogenas 0.815 0.137 0.679 1.6e-16
RGD|621881385 Idh3B "isocitrate dehydrogenas 0.815 0.137 0.679 1.6e-16
UNIPROTKB|H9L0K2385 IDH3B "Uncharacterized protein 0.815 0.137 0.660 3.4e-16
FB|FBgn0038922370 CG6439 [Drosophila melanogaste 0.815 0.143 0.716 8.3e-16
ZFIN|ZDB-GENE-040625-174383 idh3b "isocitrate dehydrogenas 0.784 0.133 0.666 9.5e-16
WB|WBGene00007993379 idhb-1 [Caenorhabditis elegans 0.784 0.134 0.725 1.5e-15
UNIPROTKB|I3L8X0 LOC100624447 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 209 (78.6 bits), Expect = 5.3e-17, P = 5.3e-17
 Identities = 36/53 (67%), Positives = 47/53 (88%)

Query:    12 QTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKG 64
             + +A+LYPKI+FE MI+DNC MQ+V NP+QFDV+VMPNLYGNI+DNLA+ + G
Sbjct:   164 EEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVG 216
GO:0051287 "NAD binding" evidence=IEA
GO:0006099 "tricarboxylic acid cycle" evidence=IEA
GO:0004449 "isocitrate dehydrogenase (NAD+) activity" evidence=IEA
GO:0000287 "magnesium ion binding" evidence=IEA
UNIPROTKB|O77784 IDH3B "Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTM3 IDH3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUB9 IDH3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43837 IDH3B "Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|621881 Idh3B "isocitrate dehydrogenase 3 (NAD+) beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0K2 IDH3B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0038922 CG6439 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-174 idh3b "isocitrate dehydrogenase 3 (NAD+) beta" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00007993 idhb-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O13696IDH1_SCHPO1, ., 1, ., 1, ., 4, 10.52940.78460.1432yesN/A
P93032IDH2_ARATH1, ., 1, ., 1, ., 4, 10.60370.81530.1444yesN/A
Q5RBT4IDH3B_PONAB1, ., 1, ., 1, ., 4, 10.67920.81530.1376yesN/A
Q5FUG5LEU3_GLUOX1, ., 1, ., 1, ., 8, 50.52080.73840.1300yesN/A
Q54B68IDHB_DICDI1, ., 1, ., 1, ., 4, 10.58820.78460.1416yesN/A
Q93353IDH3B_CAEEL1, ., 1, ., 1, ., 4, 10.69810.81530.1398yesN/A
O94229IDH1_KLULA1, ., 1, ., 1, ., 4, 10.520.76920.1385yesN/A
Q68FX0IDH3B_RAT1, ., 1, ., 1, ., 4, 10.67920.81530.1376yesN/A
O77784IDH3B_BOVIN1, ., 1, ., 1, ., 4, 10.67920.81530.1376yesN/A
O43837IDH3B_HUMAN1, ., 1, ., 1, ., 4, 10.67920.81530.1376yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
TIGR00175333 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, 8e-26
PLN00123360 PLN00123, PLN00123, isocitrate dehydrogenase (NAD+ 2e-21
COG0473348 COG0473, LeuB, Isocitrate/isopropylmalate dehydrog 1e-20
PRK09222 482 PRK09222, PRK09222, isocitrate dehydrogenase; Vali 5e-18
PLN00118372 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+ 5e-18
PRK08997334 PRK08997, PRK08997, isocitrate dehydrogenase; Prov 5e-18
PRK00772358 PRK00772, PRK00772, 3-isopropylmalate dehydrogenas 2e-17
pfam00180349 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehy 1e-16
TIGR00169346 TIGR00169, leuB, 3-isopropylmalate dehydrogenase 8e-15
TIGR02924 473 TIGR02924, ICDH_alpha, isocitrate dehydrogenase 3e-13
PLN02329 409 PLN02329, PLN02329, 3-isopropylmalate dehydrogenas 9e-11
TIGR02088322 TIGR02088, LEU3_arch, isopropylmalate/isohomocitra 9e-10
PRK03437344 PRK03437, PRK03437, 3-isopropylmalate dehydrogenas 9e-10
PRK14025330 PRK14025, PRK14025, multifunctional 3-isopropylmal 2e-09
TIGR02089352 TIGR02089, TTC, tartrate dehydrogenase 9e-09
PRK08194352 PRK08194, PRK08194, tartrate dehydrogenase; Provis 1e-07
COG0538407 COG0538, Icd, Isocitrate dehydrogenases [Energy pr 6e-05
PRK06451412 PRK06451, PRK06451, isocitrate dehydrogenase; Vali 9e-04
TIGR00183416 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase 0.001
>gnl|CDD|232856 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, NAD-dependent, mitochondrial type Back     alignment and domain information 
 Score = 95.5 bits (238), Expect = 8e-26
 Identities = 34/50 (68%), Positives = 38/50 (76%)

Query: 15  AKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKG 64
           AK YP I FE MIVDN  MQ+VS P QFDVMVMPNLYGNI+ NL + + G
Sbjct: 190 AKEYPDITFESMIVDNTCMQLVSRPSQFDVMVMPNLYGNILSNLGAGLVG 239

Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the multimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs. These enzymes dehydrogenate their substates at a H-C-OH site adjacent to a H-C-COOH site; the latter carbon, now adjacent to a carbonyl group, readily decarboxylates. Mitochondrial NAD-dependent isocitrate dehydrogenases (IDH) resemble prokaryotic NADP-dependent IDH and 3-isopropylmalate dehydrogenase (an NAD-dependent enzyme) more closely than they resemble eukaryotic NADP-dependent IDH. The mitochondrial NAD-dependent isocitrate dehydrogenase is believed to be an alpha(2)-beta-gamma heterotetramer. All subunits are homologous and found by this model. The NADP-dependent IDH of Thermus aquaticus thermophilus strain HB8 resembles these NAD-dependent IDH, except for the residues involved in cofactor specificity, much more closely than it resembles other prokaryotic NADP-dependent IDH, including that of Thermus aquaticus strain YT1 [Energy metabolism, TCA cycle]. Length = 333
>gnl|CDD|215065 PLN00123, PLN00123, isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>gnl|CDD|223549 COG0473, LeuB, Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236416 PRK09222, PRK09222, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215062 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>gnl|CDD|181606 PRK08997, PRK08997, isocitrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234832 PRK00772, PRK00772, 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215773 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|232853 TIGR00169, leuB, 3-isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|234062 TIGR02924, ICDH_alpha, isocitrate dehydrogenase Back     alignment and domain information
>gnl|CDD|215188 PLN02329, PLN02329, 3-isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|233717 TIGR02088, LEU3_arch, isopropylmalate/isohomocitrate dehydrogenases Back     alignment and domain information
>gnl|CDD|179579 PRK03437, PRK03437, 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184462 PRK14025, PRK14025, multifunctional 3-isopropylmalate dehydrogenase/D-malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233718 TIGR02089, TTC, tartrate dehydrogenase Back     alignment and domain information
>gnl|CDD|181281 PRK08194, PRK08194, tartrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223612 COG0538, Icd, Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235803 PRK06451, PRK06451, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|232862 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase, NADP-dependent, prokaryotic type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 65
COG0473348 LeuB Isocitrate/isopropylmalate dehydrogenase [Ami 99.96
PRK03437344 3-isopropylmalate dehydrogenase; Provisional 99.96
PLN02329 409 3-isopropylmalate dehydrogenase 99.96
PRK08194352 tartrate dehydrogenase; Provisional 99.96
PLN00123360 isocitrate dehydrogenase (NAD+) 99.96
TIGR02089352 TTC tartrate dehydrogenase. Tartrate dehydrogenase 99.95
PRK08997334 isocitrate dehydrogenase; Provisional 99.95
PRK14025330 multifunctional 3-isopropylmalate dehydrogenase/D- 99.95
PLN00118372 isocitrate dehydrogenase (NAD+) 99.95
TIGR00169349 leuB 3-isopropylmalate dehydrogenase. This model w 99.95
TIGR00175333 mito_nad_idh isocitrate dehydrogenase, NAD-depende 99.95
TIGR02088322 LEU3_arch isopropylmalate/isohomocitrate dehydroge 99.95
PRK00772358 3-isopropylmalate dehydrogenase; Provisional 99.94
PRK09222 482 isocitrate dehydrogenase; Validated 99.94
TIGR02924 473 ICDH_alpha isocitrate dehydrogenase. This family o 99.94
PF00180348 Iso_dh: Isocitrate/isopropylmalate dehydrogenase; 99.94
PRK06451412 isocitrate dehydrogenase; Validated 99.93
PRK07006409 isocitrate dehydrogenase; Reviewed 99.93
KOG0785|consensus365 99.93
TIGR00183416 prok_nadp_idh isocitrate dehydrogenase, NADP-depen 99.92
PRK08299 402 isocitrate dehydrogenase; Validated 99.91
TIGR00127 409 nadp_idh_euk isocitrate dehydrogenase, NADP-depend 99.91
PTZ00435 413 isocitrate dehydrogenase; Provisional 99.9
PLN00103 410 isocitrate dehydrogenase (NADP+); Provisional 99.9
PRK07362474 isocitrate dehydrogenase; Validated 99.9
KOG0784|consensus375 99.88
PLN00096 393 isocitrate dehydrogenase (NADP+); Provisional 99.88
PLN03065 483 isocitrate dehydrogenase (NADP+); Provisional 99.86
KOG0786|consensus 363 99.85
COG0538407 Icd Isocitrate dehydrogenases [Energy production a 99.52
KOG1526|consensus 422 97.23
>COG0473 LeuB Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.96  E-value=1.6e-30  Score=189.34  Aligned_cols=62  Identities=39%  Similarity=0.690  Sum_probs=60.8

Q ss_pred             hchHHHHHHHHHhhCCCceechhhHHHHHHHHhhCCCCccEEecCCchHHHHHhhhhhccCC
Q psy9334           4 RFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS   65 (65)
Q Consensus         4 ~~~f~~~~~eva~~ypdV~~~~~~vDa~~~~lv~~P~~fDVIV~~Nl~GDIlSD~aa~l~Gg   65 (65)
                      +.+|+++++|+|++||||+++|+|||+++||||++|++||||||+|||||||||+||+|+||
T Consensus       190 ~~lwrev~~eva~~yPdv~~~~~~VD~aam~lV~~P~~FDViVt~NlFGDILSD~aa~l~Gs  251 (348)
T COG0473         190 DGLWREVVEEVAKEYPDVELDHMYVDAAAMQLVRNPEQFDVIVTSNLFGDILSDEAAALTGS  251 (348)
T ss_pred             hHHHHHHHHHHhhcCCCcchhHHhHHHHHHHHhhCccccCEEEEccchhHHHHhHHHHhcCc
Confidence            57999999999999999999999999999999999999999999999999999999999997

>PRK03437 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PLN02329 3-isopropylmalate dehydrogenase Back     alignment and domain information
>PRK08194 tartrate dehydrogenase; Provisional Back     alignment and domain information
>PLN00123 isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>TIGR02089 TTC tartrate dehydrogenase Back     alignment and domain information
>PRK08997 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>PRK14025 multifunctional 3-isopropylmalate dehydrogenase/D-malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00118 isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>TIGR00169 leuB 3-isopropylmalate dehydrogenase Back     alignment and domain information
>TIGR00175 mito_nad_idh isocitrate dehydrogenase, NAD-dependent, mitochondrial type Back     alignment and domain information
>TIGR02088 LEU3_arch isopropylmalate/isohomocitrate dehydrogenases Back     alignment and domain information
>PRK00772 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PRK09222 isocitrate dehydrogenase; Validated Back     alignment and domain information
>TIGR02924 ICDH_alpha isocitrate dehydrogenase Back     alignment and domain information
>PF00180 Iso_dh: Isocitrate/isopropylmalate dehydrogenase; InterPro: IPR024084 Isocitrate dehydrogenase (IDH) [, ] is an important enzyme of carbohydrate metabolism which catalyses the oxidative decarboxylation of isocitrate into alpha-ketoglutarate Back     alignment and domain information
>PRK06451 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK07006 isocitrate dehydrogenase; Reviewed Back     alignment and domain information
>KOG0785|consensus Back     alignment and domain information
>TIGR00183 prok_nadp_idh isocitrate dehydrogenase, NADP-dependent, prokaryotic type Back     alignment and domain information
>PRK08299 isocitrate dehydrogenase; Validated Back     alignment and domain information
>TIGR00127 nadp_idh_euk isocitrate dehydrogenase, NADP-dependent, eukaryotic type Back     alignment and domain information
>PTZ00435 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>PLN00103 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>PRK07362 isocitrate dehydrogenase; Validated Back     alignment and domain information
>KOG0784|consensus Back     alignment and domain information
>PLN00096 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>PLN03065 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>KOG0786|consensus Back     alignment and domain information
>COG0538 Icd Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>KOG1526|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
3u1h_A 390 Crystal Structure Of Ipmdh From The Last Common Anc 2e-11
1v5b_A 366 The Structure Of The Mutant, S225a And E251l, Of 3- 5e-11
1v53_A 366 The Crystal Structure Of 3-Isopropylmalate Dehydrog 2e-10
2ayq_A 366 3-Isopropylmalate Dehydrogenase From The Moderate F 2e-10
3blw_A349 Yeast Isocitrate Dehydrogenase With Citrate And Amp 5e-10
1cnz_A363 3-Isopropylmalate Dehydrogenase (Ipmdh) From Salmon 3e-09
3vml_A 375 Chimera 3-Isopropylmalate Dehydrogenase Between She 4e-09
3vmk_A 375 3-Isopropylmalate Dehydrogenase From Shewanella Ben 4e-09
3blv_A 354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 8e-09
1x0l_A333 Crystal Structure Of Tetrameric Homoisocitrate Dehy 9e-09
3asj_A334 Crystal Structure Of Homoisocitrate Dehydrogenase I 9e-09
3r8w_A 405 Structure Of 3-Isopropylmalate Dehydrogenase Isofor 1e-08
1cm7_A363 3-Isopropylmalate Dehydrogenase From Escherichia Co 2e-08
1a05_A358 Crystal Structure Of The Complex Of 3-Isopropylmala 3e-08
3ah3_A334 Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehyd 1e-07
3udu_A361 Crystal Structure Of Putative 3-Isopropylmalate Deh 2e-07
3vkz_A 375 3-Isopropylmalate Dehydrogenase From Shewanella One 3e-07
4iwh_A363 Crystal Structure Of A 3-isopropylmalate Dehydrogen 3e-07
1vlc_A366 Crystal Structure Of 3-isopropylmalate Dehydrogenas 5e-07
1wpw_A336 Crystal Structure Of Ipmdh From Sulfolobus Tokodaii 1e-06
2d1c_A 496 Crystal Structure Of Tt0538 Protein From Thermus Th 1e-06
1wal_A345 3-Isopropylmalate Dehydrogenase (Ipmdh) Mutant (M21 1e-06
3blv_B354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 1e-06
3blw_B354 Yeast Isocitrate Dehydrogenase With Citrate And Amp 2e-06
1gc8_A345 The Crystal Structure Of Thermus Thermophilus 3-Iso 2e-06
1idm_A343 3-Isopropylmalate Dehydrogenase, Loop-Deleted Chime 2e-06
1dpz_A349 Stucture Of Modified 3-Isopropylmalate Dehydrogenas 2e-06
1dr0_A346 Structure Of Modified 3-isopropylmalate Dehydrogena 2e-06
1osi_A345 Structure Of 3-Isopropylmalate Dehydrogenase Length 2e-06
1xac_A345 Chimera Isopropylmalate Dehydrogenase Between Bacil 2e-06
2y3z_A 359 Structure Of Isopropylmalate Dehydrogenase From The 2e-06
1ipd_A345 Three-Dimensional Structure Of A Highly Thermostabl 2e-06
1dr8_A344 Structure Of Modified 3-Isopropylmalate Dehydrogena 2e-06
1g2u_A345 The Structure Of The Mutant, A172v, Of 3-Isopropylm 2e-06
1osj_A345 Structure Of 3-isopropylmalate Dehydrogenase Length 2e-06
1gc9_A345 The Crystal Structure Of Thermus Thermophilus 3-Iso 2e-06
3ty3_A366 Crystal Structure Of Homoisocitrate Dehydrogenase F 9e-06
1w0d_A337 The High Resolution Structure Of Mycobacterium Tube 2e-05
3udo_A361 Crystal Structure Of Putative Isopropylamlate Dehyd 3e-05
3fmx_X 364 Crystal Structure Of Tartrate Dehydrogenase From Ps 2e-04
>pdb|3U1H|A Chain A, Crystal Structure Of Ipmdh From The Last Common Ancestor Of Bacillus Length = 390 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 40/56 (71%)
Query: 10  LGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS 65
           + + +AK YP ++ E M+VDN  MQ++ NP QFDV+V  N++G+I+ + AS I GS
Sbjct: 224 VAEEVAKEYPDVELEHMLVDNAAMQLIRNPRQFDVIVTENMFGDILSDEASMITGS 279
>pdb|1V5B|A Chain A, The Structure Of The Mutant, S225a And E251l, Of 3- Isopropylmalate Dehydrogenase From Bacillus Coagulans Length = 366 Back     alignment and structure
>pdb|1V53|A Chain A, The Crystal Structure Of 3-Isopropylmalate Dehydrogenase From Bacillus Coagulans Length = 366 Back     alignment and structure
>pdb|2AYQ|A Chain A, 3-Isopropylmalate Dehydrogenase From The Moderate Facultative Thermophile, Bacillus Coagulans Length = 366 Back     alignment and structure
>pdb|3BLW|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 349 Back     alignment and structure
>pdb|1CNZ|A Chain A, 3-Isopropylmalate Dehydrogenase (Ipmdh) From Salmonella Typhimurium Length = 363 Back     alignment and structure
>pdb|3VML|A Chain A, Chimera 3-Isopropylmalate Dehydrogenase Between Shewanella Oneidensis Mr-1 (O) And Shewanella Benthica Db21 Mt-2 (M) From N-Terminal: 20% O Middle 70% M Residual 10% O Length = 375 Back     alignment and structure
>pdb|3VMK|A Chain A, 3-Isopropylmalate Dehydrogenase From Shewanella Benthica Db21 Mt-2 Length = 375 Back     alignment and structure
>pdb|3BLV|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|1X0L|A Chain A, Crystal Structure Of Tetrameric Homoisocitrate Dehydrogenase From An Extreme Thermophile, Thermus Thermophilus Length = 333 Back     alignment and structure
>pdb|3ASJ|A Chain A, Crystal Structure Of Homoisocitrate Dehydrogenase In Complex With A Designed Inhibitor Length = 334 Back     alignment and structure
>pdb|3R8W|A Chain A, Structure Of 3-Isopropylmalate Dehydrogenase Isoform 2 From Arabidopsis Thaliana At 2.2 Angstrom Resolution Length = 405 Back     alignment and structure
>pdb|1CM7|A Chain A, 3-Isopropylmalate Dehydrogenase From Escherichia Coli Length = 363 Back     alignment and structure
>pdb|1A05|A Chain A, Crystal Structure Of The Complex Of 3-Isopropylmalate Dehydrogenase From Thiobacillus Ferrooxidans With 3- Isopropylmalate Length = 358 Back     alignment and structure
>pdb|3AH3|A Chain A, Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehydrogenase Created By Directed Evolution Length = 334 Back     alignment and structure
>pdb|3UDU|A Chain A, Crystal Structure Of Putative 3-Isopropylmalate Dehydrogenase From Campylobacter Jejuni Length = 361 Back     alignment and structure
>pdb|3VKZ|A Chain A, 3-Isopropylmalate Dehydrogenase From Shewanella Oneidensis Mr-1 At Atmospheric Pressure Length = 375 Back     alignment and structure
>pdb|4IWH|A Chain A, Crystal Structure Of A 3-isopropylmalate Dehydrogenase From Burkholderia Pseudomallei Length = 363 Back     alignment and structure
>pdb|1VLC|A Chain A, Crystal Structure Of 3-isopropylmalate Dehydrogenase (tm0556) From Thermotoga Maritima At 1.90 A Resolution Length = 366 Back     alignment and structure
>pdb|1WPW|A Chain A, Crystal Structure Of Ipmdh From Sulfolobus Tokodaii Length = 336 Back     alignment and structure
>pdb|2D1C|A Chain A, Crystal Structure Of Tt0538 Protein From Thermus Thermophilus Hb8 Length = 496 Back     alignment and structure
>pdb|1WAL|A Chain A, 3-Isopropylmalate Dehydrogenase (Ipmdh) Mutant (M219a)from Thermus Thermophilus Length = 345 Back     alignment and structure
>pdb|3BLV|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|3BLW|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|1GC8|A Chain A, The Crystal Structure Of Thermus Thermophilus 3-Isopropylmalate Dehydrogenase Mutated At 172th From Ala To Phe Length = 345 Back     alignment and structure
>pdb|1IDM|A Chain A, 3-Isopropylmalate Dehydrogenase, Loop-Deleted Chimera Length = 343 Back     alignment and structure
>pdb|1DPZ|A Chain A, Stucture Of Modified 3-Isopropylmalate Dehydrogenase At The C- Terminus, Hd711 Length = 349 Back     alignment and structure
>pdb|1DR0|A Chain A, Structure Of Modified 3-isopropylmalate Dehydrogenase At The C- Terminus, Hd708 Length = 346 Back     alignment and structure
>pdb|1OSI|A Chain A, Structure Of 3-Isopropylmalate Dehydrogenase Length = 345 Back     alignment and structure
>pdb|1XAC|A Chain A, Chimera Isopropylmalate Dehydrogenase Between Bacillus Subtilis (M) And Thermus Thermophilus (T) From N-Terminal: 20% T Middle 20% M Residual 60% T, Mutated At S82r. Low Temperature (100k) Structure. Length = 345 Back     alignment and structure
>pdb|2Y3Z|A Chain A, Structure Of Isopropylmalate Dehydrogenase From Thermus Thermophilus - Apo Enzyme Length = 359 Back     alignment and structure
>pdb|1IPD|A Chain A, Three-Dimensional Structure Of A Highly Thermostable Enzyme, 3- Isopropylmalate Dehydrogenase Of Thermus Thermophilus At 2.2 Angstroms Resolution Length = 345 Back     alignment and structure
>pdb|1DR8|A Chain A, Structure Of Modified 3-Isopropylmalate Dehydrogenase At The C- Terminus, Hd177 Length = 344 Back     alignment and structure
>pdb|1G2U|A Chain A, The Structure Of The Mutant, A172v, Of 3-Isopropylmalate Dehydrogenase From Thermus Thermophilus Hb8 : Its Thermostability And Structure Length = 345 Back     alignment and structure
>pdb|1OSJ|A Chain A, Structure Of 3-isopropylmalate Dehydrogenase Length = 345 Back     alignment and structure
>pdb|1GC9|A Chain A, The Crystal Structure Of Thermus Thermophilus 3-Isopropylmalate Dehydrogenase Mutated At 172th From Ala To Gly Length = 345 Back     alignment and structure
>pdb|3TY3|A Chain A, Crystal Structure Of Homoisocitrate Dehydrogenase From Schizosaccharomyces Pombe Bound To Glycyl-Glycyl-Glycine Length = 366 Back     alignment and structure
>pdb|1W0D|A Chain A, The High Resolution Structure Of Mycobacterium Tuberculosis Leub (Rv2995c) Length = 337 Back     alignment and structure
>pdb|3UDO|A Chain A, Crystal Structure Of Putative Isopropylamlate Dehydrogenase From Campylobacter Jejuni Length = 361 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycl 7e-25
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPP 9e-25
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2 7e-24
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycl 1e-23
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, deca 1e-23
3ty4_A366 Probable homoisocitrate dehydrogenase; B-hydroxyac 1e-22
3r8w_A 405 3-isopropylmalate dehydrogenase 2, chloroplastic; 3e-18
3vmk_A 375 3-isopropylmalate dehydrogenase; oxidoreductase, d 3e-18
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogen 3e-18
3udu_A 361 3-isopropylmalate dehydrogenase; structural genomi 4e-18
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structura 4e-18
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxid 4e-18
3flk_A 364 Tartrate dehydrogenase/decarboxylase; cytoplasm, l 5e-18
3u1h_A 390 3-isopropylmalate dehydrogenase; oxidored; 2.80A { 5e-18
2y3z_A 359 3-isopropylmalate dehydrogenase; oxidoreductase, L 5e-18
3dms_A427 Isocitrate dehydrogenase [NADP]; struc genomics, s 4e-17
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, l 7e-17
1tyo_A 435 Isocitrate dehydrogenase; enzyme-ethenonadp comple 1e-16
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarbo 2e-16
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh 3e-16
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate 3e-16
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, 4e-16
>3blx_A Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_A 3blv_A* Length = 349 Back     alignment and structure
 Score = 92.7 bits (231), Expect = 7e-25
 Identities = 24/51 (47%), Positives = 34/51 (66%)

Query: 15  AKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS 65
            K YP I    +IVDN +MQ V+ PHQFDV+V P++YG I+ N+ + + G 
Sbjct: 203 QKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGG 253
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus} Length = 496 Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Length = 336 Back     alignment and structure
>3blx_B Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_B* 3blv_B Length = 354 Back     alignment and structure
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosyn; 1.85A {Thermus thermophilus} PDB: 3asj_A* 3ah3_A Length = 333 Back     alignment and structure
>3ty4_A Probable homoisocitrate dehydrogenase; B-hydroxyacid oxidative decarboxylase, amino-acid biosynthes lysine biosynthesis; 1.55A {Schizosaccharomyces pombe} PDB: 3ty3_A Length = 366 Back     alignment and structure
>3r8w_A 3-isopropylmalate dehydrogenase 2, chloroplastic; dimer, isocitrate and isopropylmalate dehydrogenases family, biosynthesis; 2.25A {Arabidopsis thaliana} Length = 405 Back     alignment and structure
>3vmk_A 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase; HET: IPM; 1.48A {Shewanella benthica} PDB: 3vmj_A* 3vl2_A* 3vkz_A* 3vl4_A* 3vl6_A* 3vl7_A* 3vl3_A* Length = 375 Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Length = 363 Back     alignment and structure
>3udu_A 3-isopropylmalate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.85A {Campylobacter jejuni} PDB: 3udo_A Length = 361 Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics PSI, protein structure initiative, joint center for structu genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Length = 366 Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Acidithiobacillus ferrooxidans} SCOP: c.77.1.1 Length = 358 Back     alignment and structure
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Length = 364 Back     alignment and structure
>3u1h_A 3-isopropylmalate dehydrogenase; oxidored; 2.80A {Bacillus SP} PDB: 2ayq_A 1v53_A 1v5b_A Length = 390 Back     alignment and structure
>2y3z_A 3-isopropylmalate dehydrogenase; oxidoreductase, LEUB, leucine biosynthesis; HET: 2PE; 1.83A {Thermus thermophilus} PDB: 2y40_A 2y41_A* 2y42_A* 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1g2u_A 1gc9_A 1osj_A 1ipd_A 1gc8_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Length = 359 Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; struc genomics, seattle structural genomics center for infectious ssgcid, glyoxylate bypass, manganese; 1.65A {Burkholderia pseudomallei} PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 3lcb_C* 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A 8icd_A* 6icd_A ... Length = 427 Back     alignment and structure
>1w0d_A 3-isopropylmalate dehydrogenase; oxidoreductase, leucine biosynthesis, NAD, ST genomics, PSI, protein structure initiative; 1.65A {Mycobacterium tuberculosis} SCOP: c.77.1.1 PDB: 2g4o_A Length = 337 Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Length = 435 Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Length = 412 Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Length = 423 Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Length = 409 Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Length = 429 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
3udu_A 361 3-isopropylmalate dehydrogenase; structural genomi 99.96
3vmk_A 375 3-isopropylmalate dehydrogenase; oxidoreductase, d 99.96
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structura 99.96
3flk_A 364 Tartrate dehydrogenase/decarboxylase; cytoplasm, l 99.96
2y3z_A 359 3-isopropylmalate dehydrogenase; oxidoreductase, L 99.96
3r8w_A 405 3-isopropylmalate dehydrogenase 2, chloroplastic; 99.96
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxid 99.96
3u1h_A 390 3-isopropylmalate dehydrogenase; oxidored; 2.80A { 99.96
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogen 99.96
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, l 99.96
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, deca 99.95
3ty4_A366 Probable homoisocitrate dehydrogenase; B-hydroxyac 99.95
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycl 99.95
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycl 99.94
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPP 99.94
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate 99.94
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarbo 99.94
3dms_A427 Isocitrate dehydrogenase [NADP]; struc genomics, s 99.94
1tyo_A 435 Isocitrate dehydrogenase; enzyme-ethenonadp comple 99.94
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, 99.93
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh 99.93
2uxq_A 402 Isocitrate dehydrogenase native; psychrophilic, co 99.92
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2 99.92
1lwd_A 413 Isocitrate dehydrogenase; tricarboxylic acid cycle 99.92
2qfy_A 427 Isocitrate dehydrogenase [NADP]; rossmann fold, ox 99.92
3us8_A 427 Isocitrate dehydrogenase [NADP]; PSI-biology, stru 99.91
1zor_A 399 Isocitrate dehydrogenase; wild type enzyme, CIS-pr 99.91
4aoy_A 402 Isocitrate dehydrogenase [NADP]; oxidoreductase, t 99.91
2af4_C333 Phosphate acetyltransferase; PTA dimer with one CO 84.52
1vmi_A355 Putative phosphate acetyltransferase; NP_416953.1, 82.36
>3udu_A 3-isopropylmalate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.85A {Campylobacter jejuni} SCOP: c.77.1.1 PDB: 3udo_A Back     alignment and structure
Probab=99.96  E-value=3.5e-30  Score=186.95  Aligned_cols=63  Identities=41%  Similarity=0.641  Sum_probs=61.2

Q ss_pred             hhchHHHHHHHHHhhCCCceechhhHHHHHHHHhhCCCCccEEecCCchHHHHHhhhhhccCC
Q psy9334           3 CRFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS   65 (65)
Q Consensus         3 ~~~~f~~~~~eva~~ypdV~~~~~~vDa~~~~lv~~P~~fDVIV~~Nl~GDIlSD~aa~l~Gg   65 (65)
                      .+.+|+++++|+|++||+|++++++||+++||||++|++||||||+|||||||||++|+++||
T Consensus       198 t~glf~~~~~eva~eypdV~~~~~~VD~~am~lv~~P~~FDViVt~NlfGDILSD~aa~l~Gs  260 (361)
T 3udu_A          198 SSILWREVVANVAKDYQDINLEYMYVDNAAMQIVKNPSIFDVMLCSNLFGDILSDELAAINGS  260 (361)
T ss_dssp             HHHHHHHHHHHHGGGCTTSEEEEEEHHHHHHHHHHCGGGCSEEEECHHHHHHHHHHHHHHHCC
T ss_pred             cchHHHHHHHHHHHHCCCCeEEeeeHHHHHHHHHhCcccCcEEEecchhHHHHHHHHHHhcCc
Confidence            456999999999999999999999999999999999999999999999999999999999997
>3vmk_A 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase; HET: IPM; 1.48A {Shewanella benthica} PDB: 3vml_A* 3vmj_A* 3vl2_A* 3vkz_A* 3vl4_A* 3vl6_A* 3vl7_A* 3vl3_A* Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics PSI, protein structure initiative, joint center for structu genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Back     alignment and structure
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Back     alignment and structure
>2y3z_A 3-isopropylmalate dehydrogenase; oxidoreductase, LEUB, leucine biosynthesis; HET: 2PE; 1.83A {Thermus thermophilus} PDB: 2y40_A 2y41_A* 2y42_A* 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1g2u_A 1gc9_A 1osj_A 1ipd_A 1gc8_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Back     alignment and structure
>3r8w_A 3-isopropylmalate dehydrogenase 2, chloroplastic; dimer, isocitrate and isopropylmalate dehydrogenases family, biosynthesis; 2.25A {Arabidopsis thaliana} Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Acidithiobacillus ferrooxidans} SCOP: c.77.1.1 Back     alignment and structure
>3u1h_A 3-isopropylmalate dehydrogenase; oxidored; 2.80A {Bacillus SP} PDB: 2ayq_A 1v53_A 1v5b_A Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Back     alignment and structure
>1w0d_A 3-isopropylmalate dehydrogenase; oxidoreductase, leucine biosynthesis, NAD, ST genomics, PSI, protein structure initiative; 1.65A {Mycobacterium tuberculosis} SCOP: c.77.1.1 PDB: 2g4o_A Back     alignment and structure
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosyn; 1.85A {Thermus thermophilus} PDB: 3asj_A* 3ah3_A Back     alignment and structure
>3ty4_A Probable homoisocitrate dehydrogenase; B-hydroxyacid oxidative decarboxylase, amino-acid biosynthes lysine biosynthesis; 1.55A {Schizosaccharomyces pombe} SCOP: c.77.1.0 PDB: 3ty3_A Back     alignment and structure
>3blx_A Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_A 3blv_A* Back     alignment and structure
>3blx_B Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_B* 3blv_B Back     alignment and structure
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus} Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; struc genomics, seattle structural genomics center for infectious ssgcid, glyoxylate bypass, manganese; 1.65A {Burkholderia pseudomallei} SCOP: c.77.1.1 PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 3lcb_C* 4aj3_A* 4aja_A* 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A ... Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Back     alignment and structure
>2uxq_A Isocitrate dehydrogenase native; psychrophilic, cold adaptation, thermal stability, oxidoreductase; HET: SO4 PEG; 1.75A {Desulfotalea psychrophila} PDB: 2uxr_A* Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Back     alignment and structure
>1lwd_A Isocitrate dehydrogenase; tricarboxylic acid cycle, oxidoreductase, NADP; HET: ICT; 1.85A {Sus scrofa} SCOP: c.77.1.1 PDB: 1t0l_A* 1t09_A* 3mas_B* 3map_A* 3mar_A* 3mas_A* 3inm_A* 2cmj_A* 2cmv_A* Back     alignment and structure
>2qfy_A Isocitrate dehydrogenase [NADP]; rossmann fold, oxidoreductase; HET: AKG; 2.10A {Saccharomyces cerevisiae} PDB: 2qfw_A* 2qfx_A* 2qfv_A* Back     alignment and structure
>3us8_A Isocitrate dehydrogenase [NADP]; PSI-biology, structural genomics; 2.25A {Sinorhizobium meliloti} Back     alignment and structure
>1zor_A Isocitrate dehydrogenase; wild type enzyme, CIS-proline, thermostable, oxidoreductase; 2.24A {Thermotoga maritima} Back     alignment and structure
>4aoy_A Isocitrate dehydrogenase [NADP]; oxidoreductase, temperature adaptation, thermophilic, psychr NADP+ selectivity, domain movements; 2.35A {Clostridium thermocellum} PDB: 4aou_A Back     alignment and structure
>2af4_C Phosphate acetyltransferase; PTA dimer with one COA ligand bound PER monomer, acyltransferase; HET: COA; 2.15A {Methanosarcina thermophila} SCOP: c.77.1.5 PDB: 1qzt_A* 2af3_C* Back     alignment and structure
>1vmi_A Putative phosphate acetyltransferase; NP_416953.1, structura genomics, JCSG, protein structure initiative, PSI, joint CE structural genomics; 2.32A {Escherichia coli} SCOP: c.77.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 65
d1hqsa_423 c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Baci 7e-11
d1vlca_362 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 7e-11
d1v53a1356 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase 4e-10
d1cnza_363 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 1e-09
d1a05a_357 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 3e-08
d1lwda_ 413 c.77.1.1 (A:) NADP-dependent isocitrate dehydrogen 1e-07
d1t0la_ 414 c.77.1.1 (A:) NADP-dependent isocitrate dehydrogen 8e-07
d1pb1a_416 c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Esch 2e-06
d1wpwa_336 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 5e-04
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} Length = 423 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: Dimeric isocitrate & isopropylmalate dehydrogenases
domain: Isocitrate dehydrogenase, ICDH
species: Bacillus subtilis [TaxId: 1423]

 Score = 53.2 bits (127), Expect = 7e-11
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 7   YPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS 65
             N  Q+ A+   KI  +  I D    QI++ P++FDV+   NL G+ + +  +   G 
Sbjct: 265 AANKAQSEAEAAGKIIIKDSIADIFLQQILTRPNEFDVVATMNLNGDYISDALAAQVGG 323
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Length = 362 Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Length = 356 Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Length = 363 Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Length = 357 Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 413 Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 414 Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Length = 416 Back     information, alignment and structure
>d1wpwa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]} Length = 336 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
d1a05a_357 3-isopropylmalate dehydrogenase, IPMDH {Thiobacill 99.95
d1vlca_362 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga 99.94
d1g2ua_345 3-isopropylmalate dehydrogenase, IPMDH {Thermus th 99.94
d1cnza_363 3-isopropylmalate dehydrogenase, IPMDH {Salmonella 99.94
d1v53a1356 3-isopropylmalate dehydrogenase, IPMDH {Bacillus c 99.94
d1w0da_337 3-isopropylmalate dehydrogenase, IPMDH {Mycobacter 99.94
d1hqsa_423 Isocitrate dehydrogenase, ICDH {Bacillus subtilis 99.91
d1pb1a_416 Isocitrate dehydrogenase, ICDH {Escherichia coli [ 99.91
d1wpwa_336 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus 99.89
d1t0la_ 414 NADP-dependent isocitrate dehydrogenase {Human (Ho 99.87
d1lwda_ 413 NADP-dependent isocitrate dehydrogenase {Pig (Sus 99.87
d2onsa1 311 Molybdate-binding protein, ModA {Archaeoglobus ful 91.19
d3thia_ 362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId 85.36
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: Dimeric isocitrate & isopropylmalate dehydrogenases
domain: 3-isopropylmalate dehydrogenase, IPMDH
species: Thiobacillus ferrooxidans [TaxId: 920]

Probab=99.95  E-value=7.9e-29  Score=176.24  Aligned_cols=62  Identities=34%  Similarity=0.649  Sum_probs=60.6

Q ss_pred             hchHHHHHHHHHhhCCCceechhhHHHHHHHHhhCCCCccEEecCCchHHHHHhhhhhccCC
Q psy9334           4 RFGYPNLGQTMAKLYPKIQFEQMIVDNCTMQIVSNPHQFDVMVMPNLYGNIVDNLASDIKGS   65 (65)
Q Consensus         4 ~~~f~~~~~eva~~ypdV~~~~~~vDa~~~~lv~~P~~fDVIV~~Nl~GDIlSD~aa~l~Gg   65 (65)
                      ..+|+++++|+|++||+|++++++||++|+|||++|++||||||+|||||||||++|+++||
T Consensus       197 ~~lf~~~~~eva~~yp~i~~~~~~vD~~~~~lv~~P~~fdViv~~Nl~GDIlSDl~a~l~Gg  258 (357)
T d1a05a_         197 TRLWREVVTEVARDYPDVRLSHMYVDNAAMQLIRAPAQFDVLLTGNMFGDILSDEASQLTGS  258 (357)
T ss_dssp             HHHHHHHHHHHGGGCTTSEEEEEEHHHHHHHHHHCGGGCSEEEECHHHHHHHHHHHHHTTSC
T ss_pred             hHHHHHHHHHHHhhCCCcEEEehHHHHHHHHHHhccccccEEechHHHHHHHHHHHHHHhcC
Confidence            46899999999999999999999999999999999999999999999999999999999997
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g2ua_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Back     information, alignment and structure
>d1w0da_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wpwa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2onsa1 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure