Diaphorina citri psyllid: psy9337

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MKQASTKYPYQANGSGQQNVSLSDRQNKIYYCTDLDKSVLINNFEKRGWIHVNSVEDDWNFYWAGIQTCRNIFSLELGYRMNDNQIINHFPNHYELTNTPTARRGKKFDLRLYVLVTSFRPLKCYLFKLGFCRFCTVKYDKNITELAARRRITTGA
ccccccccccccccccccccccccccccEEEEcccccHHHHHHccccccEEcccccccccEEEccEEEEEcccccccccccccccEEcccccCEEEcccccccccccccEEEEEEEccccccEEEEEcccCEcccccccccccccccccEEEcccc
**************************NKIYYCTDLDKSVLINNFEKRGWIHVNSVEDDWNFYWAGIQTCRNIFSLELGYRMNDNQIINHFPNHYELTNTPTARRGKKFDLRLYVLVTSFRPLKCYLFKLGFCRFCTVKYDKNITELAARRRITTG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQASTKYPYQANGSGQQNVSLSDRQNKIYYCTDLDKSVLINNFEKRGWIHVNSVEDDWNFYWAGIQTCRNIFSLELGYRMNDNQIINHFPNHYELTNTPTARRGKKFDLRLYVLVTSFRPLKCYLFKLGFCRFCTVKYDKNITELAARRRITTGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable tubulin polyglutamylase TTLL1 Catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin.confidentO95922
Probable tubulin polyglutamylase TTLL1 Catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin.confidentQ0VC71
Probable tubulin polyglutamylase TTLL1 Catalytic subunit of the neuronal tubulin polyglutamylase complex. Modifies alpha- and beta-tubulin, generating side chains of glutamate on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin.confidentQ91V51

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TIG, chain A
Confidence level:very confident
Coverage over the Query: 35-153
View the alignment between query and template
View the model in PyMOL