Diaphorina citri psyllid: psy9338

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130

IICSELDLKEDSKQLSAPSVKSKQNNIWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK

cccccccHHcccccccEEEcccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcc

IICSELDLKEDSKQLSAPSVKSKQNNIWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

IICSELDLKEDSKQLSAPSVKSKQNNIWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial		confident	Q5RBT4
Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial		confident	Q68FX0
Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial		confident	Q93353

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051287 [MF]	NAD binding	probable	GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0006103 [BP]	2-oxoglutarate metabolic process	probable	GO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0006734 [BP]	NADH metabolic process	probable	GO:0019674, GO:0006732, GO:0006733, GO:0034641, GO:0006807, GO:0044281, GO:0072524, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0071704, GO:0009987, GO:0006793, GO:0006725, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0044237, GO:0006796, GO:0019362, GO:0019637, GO:0008150, GO:0006753, GO:0046496
GO:0006102 [BP]	isocitrate metabolic process	probable	GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:0072350
GO:0005759 [CC]	mitochondrial matrix	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0004449 [MF]	isocitrate dehydrogenase (NAD+) activity	probable	GO:0016614, GO:0016616, GO:0003824, GO:0003674, GO:0004448, GO:0016491
GO:0006099 [BP]	tricarboxylic acid cycle	probable	GO:0044238, GO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0009060, GO:0008150, GO:0008152, GO:0045333, GO:0006091, GO:0055114

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D1C, chain A
Confidence level:very confident
Coverage over the Query: 5-130
View the alignment between query and template
View the model in PyMOL