Psyllid ID: psy9338

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
IICSELDLKEDSKQLSAPSVKSKQNNIWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK
cccccccHHHccccccEEEccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcc
ccHHHHHHHcccccccEEEEccccHHHHHHcccccccccccccccccccEEEccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcc
iicseldlkedskqlsapsvkskqnniwLDLRLVGgagvvagaswspecvvfepgarhtyseavgknvanptaMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGkvrtkdlggqsttQEYTYAVIANLK
iicseldlkedskqlsapsvkskqnniWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGkvrtkdlggqsttqeytyavianlk
IICSELDLKEDSKQLSAPSVKSKQNNIWLDLRLvggagvvagaSWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK
*************************NIWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVI****
IICSELDLKEDSKQLSAPSVKSKQNNIWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK
IICSELDLKEDSKQLSAPSVKSKQNNIWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK
IICSELDLKEDSKQLSAPSVKSKQNNIWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IICSELDLKEDSKQLSAPSVKSKQNNIWLDLRLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q93353379 Probable isocitrate dehyd yes N/A 0.753 0.258 0.530 2e-26
Q28479385 Isocitrate dehydrogenase N/A N/A 0.746 0.251 0.587 2e-24
O43837385 Isocitrate dehydrogenase yes N/A 0.753 0.254 0.581 2e-24
Q68FX0385 Isocitrate dehydrogenase yes N/A 0.746 0.251 0.587 3e-24
Q5RBT4385 Isocitrate dehydrogenase yes N/A 0.746 0.251 0.587 3e-24
O77784385 Isocitrate dehydrogenase yes N/A 0.746 0.251 0.577 1e-23
O94229361 Isocitrate dehydrogenase yes N/A 0.746 0.268 0.505 2e-21
P28834360 Isocitrate dehydrogenase yes N/A 0.746 0.269 0.474 2e-20
O13696356 Isocitrate dehydrogenase yes N/A 0.753 0.275 0.418 4e-18
O13302388 Isocitrate dehydrogenase N/A N/A 0.753 0.252 0.418 1e-17
>sp|Q93353|IDH3B_CAEEL Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=C37E2.1 PE=3 SV=1 Back     alignment and function desciption
 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 75/98 (76%)

Query: 33  LVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGD 92
           LVGGAGVV G S   + V+FEPG+RH++ EA+G+++ANPTAM+LC+  ML+H++L  +G+
Sbjct: 281 LVGGAGVVPGQSVGRDFVIFEPGSRHSFQEAMGRSIANPTAMILCAANMLNHLHLDAWGN 340

Query: 93  MIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK 130
            +R AV  V+K GKVRT+DLGG +TT ++  AVI   +
Sbjct: 341 SLRQAVADVVKEGKVRTRDLGGYATTVDFADAVIDKFR 378

Caenorhabditis elegans (taxid: 6239)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q28479|IDH3B_MACFA Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Macaca fascicularis GN=IDH3B PE=2 SV=2 Back     alignment and function description
>sp|O43837|IDH3B_HUMAN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens GN=IDH3B PE=1 SV=2 Back     alignment and function description
>sp|Q68FX0|IDH3B_RAT Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Rattus norvegicus GN=Idh3B PE=1 SV=1 Back     alignment and function description
>sp|Q5RBT4|IDH3B_PONAB Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Pongo abelii GN=IDH3B PE=2 SV=1 Back     alignment and function description
>sp|O77784|IDH3B_BOVIN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Bos taurus GN=IDH3B PE=2 SV=2 Back     alignment and function description
>sp|O94229|IDH1_KLULA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IDH1 PE=3 SV=1 Back     alignment and function description
>sp|P28834|IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH1 PE=1 SV=2 Back     alignment and function description
>sp|O13696|IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idh1 PE=1 SV=1 Back     alignment and function description
>sp|O13302|IDH1_AJECA Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Ajellomyces capsulatus GN=IDH1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
110611276 372 isocitrate dehydrogenase (NAD+) 2 [Gloss 0.746 0.260 0.721 6e-36
189241141 381 PREDICTED: similar to CG6439 CG6439-PA [ 0.669 0.228 0.793 3e-35
321454356 381 hypothetical protein DAPPUDRAFT_303613 [ 0.753 0.257 0.724 5e-35
427783029 380 Putative isocitrate dehydrogenase alpha 0.746 0.255 0.649 2e-33
442753867 380 Putative isocitrate dehydrogenase gamma 0.746 0.255 0.639 4e-33
346466547 401 hypothetical protein [Amblyomma maculatu 0.746 0.241 0.639 4e-33
242000462207 isocitrate dehydrogenase, putative [Ixod 0.746 0.468 0.639 6e-33
307166534 374 Probable isocitrate dehydrogenase [NAD] 0.669 0.232 0.735 2e-31
195390307 371 GJ24090 [Drosophila virilis] gi|19415189 0.661 0.231 0.720 2e-31
66530240 374 PREDICTED: isocitrate dehydrogenase [NAD 0.669 0.232 0.735 4e-31
>gi|110611276|gb|ABG77987.1| isocitrate dehydrogenase (NAD+) 2 [Glossina morsitans morsitans] gi|289739787|gb|ADD18641.1| isocitrate dehydrogenase 2 NAD+ [Glossina morsitans morsitans] Back     alignment and taxonomy information
 Score =  155 bits (391), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 83/97 (85%)

Query: 33  LVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGD 92
           +VGGAG+VAGAS+SP+ VVFEPGARHT+SEAVGKNVANPTAM  C TK+L H+NL  Y +
Sbjct: 275 IVGGAGLVAGASYSPDTVVFEPGARHTFSEAVGKNVANPTAMFFCGTKLLRHINLPTYSE 334

Query: 93  MIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANL 129
           M+ NA+ RVL  GKVRTKDLGG +TTQE+T AVIAN+
Sbjct: 335 MLTNAIIRVLSEGKVRTKDLGGNATTQEFTRAVIANI 371

Source: Glossina morsitans morsitans

Species: Glossina morsitans

Genus: Glossina

Family: Glossinidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189241141|ref|XP_973953.2| PREDICTED: similar to CG6439 CG6439-PA [Tribolium castaneum] gi|270013913|gb|EFA10361.1| hypothetical protein TcasGA2_TC012587 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321454356|gb|EFX65530.1| hypothetical protein DAPPUDRAFT_303613 [Daphnia pulex] Back     alignment and taxonomy information
>gi|427783029|gb|JAA56966.1| Putative isocitrate dehydrogenase alpha subunit [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|442753867|gb|JAA69093.1| Putative isocitrate dehydrogenase gamma subunit [Ixodes ricinus] Back     alignment and taxonomy information
>gi|346466547|gb|AEO33118.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|242000462|ref|XP_002434874.1| isocitrate dehydrogenase, putative [Ixodes scapularis] gi|215498204|gb|EEC07698.1| isocitrate dehydrogenase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|307166534|gb|EFN60601.1| Probable isocitrate dehydrogenase [NAD] subunit beta, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|195390307|ref|XP_002053810.1| GJ24090 [Drosophila virilis] gi|194151896|gb|EDW67330.1| GJ24090 [Drosophila virilis] Back     alignment and taxonomy information
>gi|66530240|ref|XP_624511.1| PREDICTED: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0038922370 CG6439 [Drosophila melanogaste 0.661 0.232 0.709 5.5e-32
UNIPROTKB|F1PTM3383 IDH3B "Uncharacterized protein 0.661 0.224 0.569 1.2e-24
UNIPROTKB|E2QUB9385 IDH3B "Uncharacterized protein 0.661 0.223 0.558 1.5e-24
RGD|621881385 Idh3B "isocitrate dehydrogenas 0.661 0.223 0.558 1.9e-24
UNIPROTKB|O77784385 IDH3B "Isocitrate dehydrogenas 0.661 0.223 0.546 7.3e-24
UNIPROTKB|H9L0K2385 IDH3B "Uncharacterized protein 0.661 0.223 0.546 9.7e-24
ZFIN|ZDB-GENE-040625-174383 idh3b "isocitrate dehydrogenas 0.661 0.224 0.569 3.8e-23
UNIPROTKB|O43837385 IDH3B "Isocitrate dehydrogenas 0.669 0.225 0.551 1e-22
UNIPROTKB|I3L8X0312 LOC100624447 "Uncharacterized 0.661 0.275 0.569 1e-22
UNIPROTKB|F1S897383 IDH3B "Isocitrate dehydrogenas 0.661 0.224 0.558 1.3e-22
FB|FBgn0038922 CG6439 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 331 (121.6 bits), Expect = 5.5e-32, Sum P(2) = 5.5e-32
 Identities = 61/86 (70%), Positives = 75/86 (87%)

Query:    44 SWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLK 103
             S+S E VVFEPGARHT++EAVGKNVANPTAMLLC  K+L H+NL  YG++I+NA+N+VL 
Sbjct:   284 SYSSESVVFEPGARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLN 343

Query:   104 AGKVRTKDLGGQSTTQEYTYAVIANL 129
              GKVRTKDLGGQSTTQ++T A+I N+
Sbjct:   344 DGKVRTKDLGGQSTTQDFTRAIILNM 369
GO:0004449 "isocitrate dehydrogenase (NAD+) activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISS
GO:0006099 "tricarboxylic acid cycle" evidence=ISS
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|F1PTM3 IDH3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUB9 IDH3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|621881 Idh3B "isocitrate dehydrogenase 3 (NAD+) beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O77784 IDH3B "Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0K2 IDH3B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-174 idh3b "isocitrate dehydrogenase 3 (NAD+) beta" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O43837 IDH3B "Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L8X0 LOC100624447 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1S897 IDH3B "Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RBT4IDH3B_PONAB1, ., 1, ., 1, ., 4, 10.58760.74610.2519yesN/A
Q93353IDH3B_CAEEL1, ., 1, ., 1, ., 4, 10.53060.75380.2585yesN/A
O94229IDH1_KLULA1, ., 1, ., 1, ., 4, 10.50510.74610.2686yesN/A
Q68FX0IDH3B_RAT1, ., 1, ., 1, ., 4, 10.58760.74610.2519yesN/A
O77784IDH3B_BOVIN1, ., 1, ., 1, ., 4, 10.57730.74610.2519yesN/A
O43837IDH3B_HUMAN1, ., 1, ., 1, ., 4, 10.58160.75380.2545yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
TIGR00175333 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, 2e-36
COG0473348 COG0473, LeuB, Isocitrate/isopropylmalate dehydrog 6e-24
PLN00123360 PLN00123, PLN00123, isocitrate dehydrogenase (NAD+ 1e-22
PRK08997334 PRK08997, PRK08997, isocitrate dehydrogenase; Prov 2e-21
PLN00118372 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+ 2e-20
pfam00180349 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehy 3e-14
TIGR02088322 TIGR02088, LEU3_arch, isopropylmalate/isohomocitra 5e-14
PRK14025330 PRK14025, PRK14025, multifunctional 3-isopropylmal 8e-14
PRK00772358 PRK00772, PRK00772, 3-isopropylmalate dehydrogenas 9e-12
PRK08194352 PRK08194, PRK08194, tartrate dehydrogenase; Provis 2e-11
COG0538407 COG0538, Icd, Isocitrate dehydrogenases [Energy pr 8e-11
TIGR02089352 TIGR02089, TTC, tartrate dehydrogenase 3e-10
PRK09222 482 PRK09222, PRK09222, isocitrate dehydrogenase; Vali 1e-08
TIGR00183416 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase 7e-08
TIGR00169346 TIGR00169, leuB, 3-isopropylmalate dehydrogenase 1e-07
PRK06451412 PRK06451, PRK06451, isocitrate dehydrogenase; Vali 9e-07
PRK07006409 PRK07006, PRK07006, isocitrate dehydrogenase; Revi 3e-06
TIGR02924 473 TIGR02924, ICDH_alpha, isocitrate dehydrogenase 2e-05
PRK07362474 PRK07362, PRK07362, isocitrate dehydrogenase; Vali 7e-04
PRK03437344 PRK03437, PRK03437, 3-isopropylmalate dehydrogenas 0.003
PRK09954 362 PRK09954, PRK09954, putative kinase; Provisional 0.003
>gnl|CDD|232856 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, NAD-dependent, mitochondrial type Back     alignment and domain information 
 Score =  126 bits (318), Expect = 2e-36
 Identities = 49/97 (50%), Positives = 66/97 (68%)

Query: 33  LVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGD 92
           LVGG G+V GA+   +  VFEPG RHT  +  G+N+ANPTA++L S  ML+H+ L+ + D
Sbjct: 237 LVGGPGLVPGANIGRDYAVFEPGVRHTGPDIAGQNIANPTALILSSVMMLNHLGLKEHAD 296

Query: 93  MIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANL 129
            I+ AV   +  GK RTKDLGG +TT ++T AVI  L
Sbjct: 297 RIQKAVLSTIAEGKNRTKDLGGTATTSDFTEAVIKRL 333

Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the multimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs. These enzymes dehydrogenate their substates at a H-C-OH site adjacent to a H-C-COOH site; the latter carbon, now adjacent to a carbonyl group, readily decarboxylates. Mitochondrial NAD-dependent isocitrate dehydrogenases (IDH) resemble prokaryotic NADP-dependent IDH and 3-isopropylmalate dehydrogenase (an NAD-dependent enzyme) more closely than they resemble eukaryotic NADP-dependent IDH. The mitochondrial NAD-dependent isocitrate dehydrogenase is believed to be an alpha(2)-beta-gamma heterotetramer. All subunits are homologous and found by this model. The NADP-dependent IDH of Thermus aquaticus thermophilus strain HB8 resembles these NAD-dependent IDH, except for the residues involved in cofactor specificity, much more closely than it resembles other prokaryotic NADP-dependent IDH, including that of Thermus aquaticus strain YT1 [Energy metabolism, TCA cycle]. Length = 333
>gnl|CDD|223549 COG0473, LeuB, Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215065 PLN00123, PLN00123, isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>gnl|CDD|181606 PRK08997, PRK08997, isocitrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215062 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>gnl|CDD|215773 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|233717 TIGR02088, LEU3_arch, isopropylmalate/isohomocitrate dehydrogenases Back     alignment and domain information
>gnl|CDD|184462 PRK14025, PRK14025, multifunctional 3-isopropylmalate dehydrogenase/D-malate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|234832 PRK00772, PRK00772, 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181281 PRK08194, PRK08194, tartrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223612 COG0538, Icd, Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233718 TIGR02089, TTC, tartrate dehydrogenase Back     alignment and domain information
>gnl|CDD|236416 PRK09222, PRK09222, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|232862 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase, NADP-dependent, prokaryotic type Back     alignment and domain information
>gnl|CDD|232853 TIGR00169, leuB, 3-isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|235803 PRK06451, PRK06451, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180792 PRK07006, PRK07006, isocitrate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|234062 TIGR02924, ICDH_alpha, isocitrate dehydrogenase Back     alignment and domain information
>gnl|CDD|180944 PRK07362, PRK07362, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|179579 PRK03437, PRK03437, 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182165 PRK09954, PRK09954, putative kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
COG0473348 LeuB Isocitrate/isopropylmalate dehydrogenase [Ami 100.0
TIGR00175333 mito_nad_idh isocitrate dehydrogenase, NAD-depende 100.0
PRK08997334 isocitrate dehydrogenase; Provisional 100.0
PLN00123360 isocitrate dehydrogenase (NAD+) 100.0
PRK14025330 multifunctional 3-isopropylmalate dehydrogenase/D- 100.0
PRK08194352 tartrate dehydrogenase; Provisional 100.0
PLN00118372 isocitrate dehydrogenase (NAD+) 100.0
TIGR02089352 TTC tartrate dehydrogenase. Tartrate dehydrogenase 100.0
PLN02329409 3-isopropylmalate dehydrogenase 100.0
KOG0785|consensus365 100.0
PRK06451412 isocitrate dehydrogenase; Validated 100.0
TIGR00169349 leuB 3-isopropylmalate dehydrogenase. This model w 100.0
PRK07006409 isocitrate dehydrogenase; Reviewed 100.0
TIGR02924 473 ICDH_alpha isocitrate dehydrogenase. This family o 100.0
PRK07362474 isocitrate dehydrogenase; Validated 100.0
TIGR00183416 prok_nadp_idh isocitrate dehydrogenase, NADP-depen 100.0
PRK09222 482 isocitrate dehydrogenase; Validated 100.0
PRK00772358 3-isopropylmalate dehydrogenase; Provisional 100.0
PRK03437344 3-isopropylmalate dehydrogenase; Provisional 100.0
PF00180348 Iso_dh: Isocitrate/isopropylmalate dehydrogenase; 100.0
TIGR02088322 LEU3_arch isopropylmalate/isohomocitrate dehydroge 100.0
PRK08299402 isocitrate dehydrogenase; Validated 100.0
PLN00103410 isocitrate dehydrogenase (NADP+); Provisional 100.0
PTZ00435413 isocitrate dehydrogenase; Provisional 100.0
KOG0784|consensus375 100.0
PLN00096393 isocitrate dehydrogenase (NADP+); Provisional 100.0
TIGR00127409 nadp_idh_euk isocitrate dehydrogenase, NADP-depend 100.0
PLN03065483 isocitrate dehydrogenase (NADP+); Provisional 100.0
KOG0786|consensus363 100.0
COG0538407 Icd Isocitrate dehydrogenases [Energy production a 100.0
KOG1526|consensus422 99.56
TIGR00178741 monomer_idh isocitrate dehydrogenase, NADP-depende 96.17
PF03971735 IDH: Monomeric isocitrate dehydrogenase; InterPro: 96.01
PF04166298 PdxA: Pyridoxal phosphate biosynthetic protein Pdx 95.84
PRK03371326 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 95.22
PRK00232332 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 95.12
PRK03743332 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 95.04
COG2838744 Icd Monomeric isocitrate dehydrogenase [Energy pro 94.91
TIGR00557320 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase. 94.9
PRK01909329 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 94.89
PRK05312336 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 94.84
PRK02746345 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 94.77
PRK03946307 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; 94.74
COG1995332 PdxA Pyridoxal phosphate biosynthesis protein [Coe 94.56
>COG0473 LeuB Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.3e-56  Score=367.02  Aligned_cols=125  Identities=33%  Similarity=0.471  Sum_probs=121.1

Q ss_pred             cchhhhcCCCCceeeeCCcchhhhhhh--hhcccccccccccCCCC--cceeccCCCCccccccCCcccChHHHHHHHHH
Q psy9338           5 ELDLKEDSKQLSAPSVKSKQNNIWLDL--RLVGGAGVVAGASWSPE--CVVFEPGARHTYSEAVGKNVANPTAMLLCSTK   80 (130)
Q Consensus         5 ~~~lv~~P~~fdViv~~Nl~GDIlsd~--~l~Gg~Gl~ps~nig~~--~~~fEp~h~GsapdiaGk~~ANP~a~ils~am   80 (130)
                      +||||++|++||||||+|||||||||+  +++||+||+||+|+|++  ++||||+| ||||||||||||||+|+|||++|
T Consensus       218 am~lV~~P~~FDViVt~NlFGDILSD~aa~l~GslGl~PSAnig~~~~~~lfEPvH-GSAPDIAGkgiANPiA~IlS~aM  296 (348)
T COG0473         218 AMQLVRNPEQFDVIVTSNLFGDILSDEAAALTGSLGLAPSANLGDERGPALFEPVH-GSAPDIAGKGIANPIATILSAAM  296 (348)
T ss_pred             HHHHhhCccccCEEEEccchhHHHHhHHHHhcCccccCccCccCCCCCCceeecCC-CCcccccCCCccChHHHHHHHHH
Confidence            599999999999999999999999999  99999999999999997  99999999 99999999999999999999999


Q ss_pred             HhhhcCcHHHHHHHHHHHHHHHHcCCcccCCCCCCCCHHHHHHHHHHhcC
Q psy9338          81 MLSHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK  130 (130)
Q Consensus        81 mL~~lg~~~~A~~i~~Av~~~l~~g~~~T~DlgG~~tT~e~~~avi~~l~  130 (130)
                      ||+|+|..++|++|++||+++++++++||+||||+.+|.||+++|+++|+
T Consensus       297 ML~~~g~~~~A~~Ie~Av~~vl~~~g~~T~Dlgg~~~T~e~~d~I~~~l~  346 (348)
T COG0473         297 MLRHLGEKEAADAIENAVEKVLAEGGIRTPDLGGNATTSEVGDAIAKALA  346 (348)
T ss_pred             HHHHhCCchHHHHHHHHHHHHHHcCCCCCcccCCCccHHHHHHHHHHHHh
Confidence            99999999999999999999999744899999999999999999999874

>TIGR00175 mito_nad_idh isocitrate dehydrogenase, NAD-dependent, mitochondrial type Back     alignment and domain information
>PRK08997 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>PLN00123 isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>PRK14025 multifunctional 3-isopropylmalate dehydrogenase/D-malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08194 tartrate dehydrogenase; Provisional Back     alignment and domain information
>PLN00118 isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>TIGR02089 TTC tartrate dehydrogenase Back     alignment and domain information
>PLN02329 3-isopropylmalate dehydrogenase Back     alignment and domain information
>KOG0785|consensus Back     alignment and domain information
>PRK06451 isocitrate dehydrogenase; Validated Back     alignment and domain information
>TIGR00169 leuB 3-isopropylmalate dehydrogenase Back     alignment and domain information
>PRK07006 isocitrate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02924 ICDH_alpha isocitrate dehydrogenase Back     alignment and domain information
>PRK07362 isocitrate dehydrogenase; Validated Back     alignment and domain information
>TIGR00183 prok_nadp_idh isocitrate dehydrogenase, NADP-dependent, prokaryotic type Back     alignment and domain information
>PRK09222 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK00772 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PRK03437 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PF00180 Iso_dh: Isocitrate/isopropylmalate dehydrogenase; InterPro: IPR024084 Isocitrate dehydrogenase (IDH) [, ] is an important enzyme of carbohydrate metabolism which catalyses the oxidative decarboxylation of isocitrate into alpha-ketoglutarate Back     alignment and domain information
>TIGR02088 LEU3_arch isopropylmalate/isohomocitrate dehydrogenases Back     alignment and domain information
>PRK08299 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PLN00103 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>PTZ00435 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>KOG0784|consensus Back     alignment and domain information
>PLN00096 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>TIGR00127 nadp_idh_euk isocitrate dehydrogenase, NADP-dependent, eukaryotic type Back     alignment and domain information
>PLN03065 isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>KOG0786|consensus Back     alignment and domain information
>COG0538 Icd Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>KOG1526|consensus Back     alignment and domain information
>TIGR00178 monomer_idh isocitrate dehydrogenase, NADP-dependent, monomeric type Back     alignment and domain information
>PF03971 IDH: Monomeric isocitrate dehydrogenase; InterPro: IPR004436 This family of enzymes catalyses the NADP(+)-dependent oxidative decarboxylation of isocitrate to form 2-oxoglutarate, CO2, and NADPH within the Krebs cycle (1 Back     alignment and domain information
>PF04166 PdxA: Pyridoxal phosphate biosynthetic protein PdxA; InterPro: IPR005255 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK03371 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Provisional Back     alignment and domain information
>PRK00232 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK03743 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG2838 Icd Monomeric isocitrate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR00557 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase Back     alignment and domain information
>PRK01909 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05312 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK02746 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK03946 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1995 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3blw_A349 Yeast Isocitrate Dehydrogenase With Citrate And Amp 2e-16
3blv_A354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 7e-15
3blw_B354 Yeast Isocitrate Dehydrogenase With Citrate And Amp 9e-10
1x0l_A333 Crystal Structure Of Tetrameric Homoisocitrate Dehy 9e-10
3asj_A334 Crystal Structure Of Homoisocitrate Dehydrogenase I 9e-10
3ah3_A334 Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehyd 4e-09
2d1c_A 496 Crystal Structure Of Tt0538 Protein From Thermus Th 4e-08
3ty3_A366 Crystal Structure Of Homoisocitrate Dehydrogenase F 4e-08
3blv_B354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 6e-06
3fmx_X364 Crystal Structure Of Tartrate Dehydrogenase From Ps 2e-05
1ipd_A345 Three-Dimensional Structure Of A Highly Thermostabl 2e-05
1wal_A345 3-Isopropylmalate Dehydrogenase (Ipmdh) Mutant (M21 2e-05
1idm_A343 3-Isopropylmalate Dehydrogenase, Loop-Deleted Chime 2e-05
1gc9_A345 The Crystal Structure Of Thermus Thermophilus 3-Iso 2e-05
1g2u_A345 The Structure Of The Mutant, A172v, Of 3-Isopropylm 2e-05
1osj_A345 Structure Of 3-isopropylmalate Dehydrogenase Length 2e-05
1gc8_A345 The Crystal Structure Of Thermus Thermophilus 3-Iso 2e-05
1osi_A345 Structure Of 3-Isopropylmalate Dehydrogenase Length 2e-05
1xac_A345 Chimera Isopropylmalate Dehydrogenase Between Bacil 2e-05
1dr0_A346 Structure Of Modified 3-isopropylmalate Dehydrogena 3e-05
2y3z_A359 Structure Of Isopropylmalate Dehydrogenase From The 4e-05
1dpz_A349 Stucture Of Modified 3-Isopropylmalate Dehydrogenas 7e-05
1dr8_A344 Structure Of Modified 3-Isopropylmalate Dehydrogena 7e-05
2iv0_A412 Thermal Stability Of Isocitrate Dehydrogenase From 1e-04
>pdb|3BLW|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 349 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (63%)
Query: 44  SWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGDMIRNAVNRVLK 103
           ++  +  VFEPG+RH   +  G+NVANPTAM+L ST ML+H+ L  Y   I  AV+  + 
Sbjct: 261 NFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIA 320
Query: 104 AGKVRTKDLGGQSTTQEYTYAVIANL 129
            GK  T+D+GG S+T ++T  +I  L
Sbjct: 321 EGKHTTRDIGGSSSTTDFTNEIINKL 346
>pdb|3BLV|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|3BLW|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|1X0L|A Chain A, Crystal Structure Of Tetrameric Homoisocitrate Dehydrogenase From An Extreme Thermophile, Thermus Thermophilus Length = 333 Back     alignment and structure
>pdb|3ASJ|A Chain A, Crystal Structure Of Homoisocitrate Dehydrogenase In Complex With A Designed Inhibitor Length = 334 Back     alignment and structure
>pdb|3AH3|A Chain A, Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehydrogenase Created By Directed Evolution Length = 334 Back     alignment and structure
>pdb|2D1C|A Chain A, Crystal Structure Of Tt0538 Protein From Thermus Thermophilus Hb8 Length = 496 Back     alignment and structure
>pdb|3TY3|A Chain A, Crystal Structure Of Homoisocitrate Dehydrogenase From Schizosaccharomyces Pombe Bound To Glycyl-Glycyl-Glycine Length = 366 Back     alignment and structure
>pdb|3BLV|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>pdb|1IPD|A Chain A, Three-Dimensional Structure Of A Highly Thermostable Enzyme, 3- Isopropylmalate Dehydrogenase Of Thermus Thermophilus At 2.2 Angstroms Resolution Length = 345 Back     alignment and structure
>pdb|1WAL|A Chain A, 3-Isopropylmalate Dehydrogenase (Ipmdh) Mutant (M219a)from Thermus Thermophilus Length = 345 Back     alignment and structure
>pdb|1IDM|A Chain A, 3-Isopropylmalate Dehydrogenase, Loop-Deleted Chimera Length = 343 Back     alignment and structure
>pdb|1GC9|A Chain A, The Crystal Structure Of Thermus Thermophilus 3-Isopropylmalate Dehydrogenase Mutated At 172th From Ala To Gly Length = 345 Back     alignment and structure
>pdb|1G2U|A Chain A, The Structure Of The Mutant, A172v, Of 3-Isopropylmalate Dehydrogenase From Thermus Thermophilus Hb8 : Its Thermostability And Structure Length = 345 Back     alignment and structure
>pdb|1OSJ|A Chain A, Structure Of 3-isopropylmalate Dehydrogenase Length = 345 Back     alignment and structure
>pdb|1GC8|A Chain A, The Crystal Structure Of Thermus Thermophilus 3-Isopropylmalate Dehydrogenase Mutated At 172th From Ala To Phe Length = 345 Back     alignment and structure
>pdb|1OSI|A Chain A, Structure Of 3-Isopropylmalate Dehydrogenase Length = 345 Back     alignment and structure
>pdb|1XAC|A Chain A, Chimera Isopropylmalate Dehydrogenase Between Bacillus Subtilis (M) And Thermus Thermophilus (T) From N-Terminal: 20% T Middle 20% M Residual 60% T, Mutated At S82r. Low Temperature (100k) Structure. Length = 345 Back     alignment and structure
>pdb|1DR0|A Chain A, Structure Of Modified 3-isopropylmalate Dehydrogenase At The C- Terminus, Hd708 Length = 346 Back     alignment and structure
>pdb|2Y3Z|A Chain A, Structure Of Isopropylmalate Dehydrogenase From Thermus Thermophilus - Apo Enzyme Length = 359 Back     alignment and structure
>pdb|1DPZ|A Chain A, Stucture Of Modified 3-Isopropylmalate Dehydrogenase At The C- Terminus, Hd711 Length = 349 Back     alignment and structure
>pdb|1DR8|A Chain A, Structure Of Modified 3-Isopropylmalate Dehydrogenase At The C- Terminus, Hd177 Length = 344 Back     alignment and structure
>pdb|2IV0|A Chain A, Thermal Stability Of Isocitrate Dehydrogenase From Archaeoglobus Fulgidus Studied By Crystal Structure Analysis And Engineering Of Chimers Length = 412 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycl 5e-40
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycl 2e-35
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPP 2e-34
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2 1e-31
3ty4_A366 Probable homoisocitrate dehydrogenase; B-hydroxyac 1e-30
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, deca 2e-29
3dms_A427 Isocitrate dehydrogenase [NADP]; struc genomics, s 2e-23
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, 6e-23
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarbo 2e-22
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate 4e-22
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh 2e-21
1tyo_A435 Isocitrate dehydrogenase; enzyme-ethenonadp comple 7e-21
3flk_A364 Tartrate dehydrogenase/decarboxylase; cytoplasm, l 1e-16
2y3z_A359 3-isopropylmalate dehydrogenase; oxidoreductase, L 2e-13
3udu_A361 3-isopropylmalate dehydrogenase; structural genomi 3e-12
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxid 1e-11
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structura 3e-11
3r8w_A405 3-isopropylmalate dehydrogenase 2, chloroplastic; 4e-11
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogen 6e-11
3vmk_A375 3-isopropylmalate dehydrogenase; oxidoreductase, d 7e-11
3u1h_A390 3-isopropylmalate dehydrogenase; oxidored; 2.80A { 8e-11
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, l 1e-10
1zor_A399 Isocitrate dehydrogenase; wild type enzyme, CIS-pr 2e-04
2uxq_A402 Isocitrate dehydrogenase native; psychrophilic, co 7e-04
>3blx_A Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_A 3blv_A* Length = 349 Back     alignment and structure
 Score =  135 bits (342), Expect = 5e-40
 Identities = 46/98 (46%), Positives = 65/98 (66%)

Query: 33  LVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHVNLQYYGD 92
           L+GG G+VAGA++  +  VFEPG+RH   +  G+NVANPTAM+L ST ML+H+ L  Y  
Sbjct: 250 LIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYAT 309

Query: 93  MIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK 130
            I  AV+  +  GK  T+D+GG S+T ++T  +I  L 
Sbjct: 310 RISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKLS 347
>3blx_B Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_B* 3blv_B Length = 354 Back     alignment and structure
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus} Length = 496 Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Length = 336 Back     alignment and structure
>3ty4_A Probable homoisocitrate dehydrogenase; B-hydroxyacid oxidative decarboxylase, amino-acid biosynthes lysine biosynthesis; 1.55A {Schizosaccharomyces pombe} PDB: 3ty3_A Length = 366 Back     alignment and structure
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosyn; 1.85A {Thermus thermophilus} PDB: 3asj_A* 3ah3_A Length = 333 Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; struc genomics, seattle structural genomics center for infectious ssgcid, glyoxylate bypass, manganese; 1.65A {Burkholderia pseudomallei} PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 3lcb_C* 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A 8icd_A* 6icd_A ... Length = 427 Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Length = 429 Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Length = 412 Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Length = 409 Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Length = 423 Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Length = 435 Back     alignment and structure
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Length = 364 Back     alignment and structure
>2y3z_A 3-isopropylmalate dehydrogenase; oxidoreductase, LEUB, leucine biosynthesis; HET: 2PE; 1.83A {Thermus thermophilus} PDB: 2y40_A 2y41_A* 2y42_A* 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1g2u_A 1gc9_A 1osj_A 1ipd_A 1gc8_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Length = 359 Back     alignment and structure
>3udu_A 3-isopropylmalate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.85A {Campylobacter jejuni} PDB: 3udo_A Length = 361 Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Acidithiobacillus ferrooxidans} SCOP: c.77.1.1 Length = 358 Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics PSI, protein structure initiative, joint center for structu genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Length = 366 Back     alignment and structure
>3r8w_A 3-isopropylmalate dehydrogenase 2, chloroplastic; dimer, isocitrate and isopropylmalate dehydrogenases family, biosynthesis; 2.25A {Arabidopsis thaliana} Length = 405 Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Length = 363 Back     alignment and structure
>3vmk_A 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase; HET: IPM; 1.48A {Shewanella benthica} PDB: 3vmj_A* 3vl2_A* 3vkz_A* 3vl4_A* 3vl6_A* 3vl7_A* 3vl3_A* Length = 375 Back     alignment and structure
>3u1h_A 3-isopropylmalate dehydrogenase; oxidored; 2.80A {Bacillus SP} PDB: 2ayq_A 1v53_A 1v5b_A Length = 390 Back     alignment and structure
>1w0d_A 3-isopropylmalate dehydrogenase; oxidoreductase, leucine biosynthesis, NAD, ST genomics, PSI, protein structure initiative; 1.65A {Mycobacterium tuberculosis} SCOP: c.77.1.1 PDB: 2g4o_A Length = 337 Back     alignment and structure
>1zor_A Isocitrate dehydrogenase; wild type enzyme, CIS-proline, thermostable, oxidoreductase; 2.24A {Thermotoga maritima} Length = 399 Back     alignment and structure
>2uxq_A Isocitrate dehydrogenase native; psychrophilic, cold adaptation, thermal stability, oxidoreductase; HET: SO4 PEG; 1.75A {Desulfotalea psychrophila} PDB: 2uxr_A* Length = 402 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
3ty4_A366 Probable homoisocitrate dehydrogenase; B-hydroxyac 100.0
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycl 100.0
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, deca 100.0
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2 100.0
3udu_A361 3-isopropylmalate dehydrogenase; structural genomi 100.0
3flk_A364 Tartrate dehydrogenase/decarboxylase; cytoplasm, l 100.0
2y3z_A359 3-isopropylmalate dehydrogenase; oxidoreductase, L 100.0
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogen 100.0
3vmk_A375 3-isopropylmalate dehydrogenase; oxidoreductase, d 100.0
3dms_A427 Isocitrate dehydrogenase [NADP]; struc genomics, s 100.0
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycl 100.0
3u1h_A390 3-isopropylmalate dehydrogenase; oxidored; 2.80A { 100.0
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxid 100.0
3r8w_A405 3-isopropylmalate dehydrogenase 2, chloroplastic; 100.0
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structura 100.0
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate 100.0
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarbo 100.0
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPP 100.0
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh 100.0
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, 100.0
1tyo_A435 Isocitrate dehydrogenase; enzyme-ethenonadp comple 100.0
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, l 100.0
2uxq_A402 Isocitrate dehydrogenase native; psychrophilic, co 100.0
1zor_A399 Isocitrate dehydrogenase; wild type enzyme, CIS-pr 100.0
3us8_A427 Isocitrate dehydrogenase [NADP]; PSI-biology, stru 100.0
2qfy_A427 Isocitrate dehydrogenase [NADP]; rossmann fold, ox 100.0
1lwd_A413 Isocitrate dehydrogenase; tricarboxylic acid cycle 100.0
4aoy_A402 Isocitrate dehydrogenase [NADP]; oxidoreductase, t 100.0
2b0t_A738 NADP isocitrate dehydrogenase; monomeric, IDH, oxi 96.07
1itw_A741 Isocitrate dehydrogenase; greece KEY motif, oxidor 96.07
4aty_A349 Terephthalate 1,2-CIS-dihydrodiol dehydrogenase; o 95.6
2hi1_A330 4-hydroxythreonine-4-phosphate dehydrogenase 2; py 95.21
1yxo_A328 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA 95.2
3lxy_A334 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA 95.11
3tsn_A367 4-hydroxythreonine-4-phosphate dehydrogenase; stru 94.26
>3ty4_A Probable homoisocitrate dehydrogenase; B-hydroxyacid oxidative decarboxylase, amino-acid biosynthes lysine biosynthesis; 1.55A {Schizosaccharomyces pombe} SCOP: c.77.1.0 PDB: 3ty3_A Back     alignment and structure
Probab=100.00  E-value=2e-55  Score=367.08  Aligned_cols=125  Identities=32%  Similarity=0.396  Sum_probs=122.1

Q ss_pred             cchhhhcCCCCceeeeCCcchhhhhhh--hhcccccccccccCCCCcceeccCCCCccccccCCcccChHHHHHHHHHHh
Q psy9338           5 ELDLKEDSKQLSAPSVKSKQNNIWLDL--RLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKML   82 (130)
Q Consensus         5 ~~~lv~~P~~fdViv~~Nl~GDIlsd~--~l~Gg~Gl~ps~nig~~~~~fEp~h~GsapdiaGk~~ANP~a~ils~ammL   82 (130)
                      +||||++|++||||||+|||||||||+  +++||+||+||+|+|+.++||||+| ||||||+|||+|||+|+|||++|||
T Consensus       239 am~lv~~P~~FDViVt~NlfGDILSD~aa~l~GslGl~pSanig~~~a~fEpvH-GSAPdIaGk~iANP~A~IlS~amML  317 (366)
T 3ty4_A          239 VYRLFREPECFDVVVAPNLYGDILSDGAASLIGSLGLVPSANVGDNFVMSEPVH-GSAPDIAGRGIANPVATFRSVALML  317 (366)
T ss_dssp             HHHHHHCGGGCSEEEECHHHHHHHHHHHHGGGSCGGGCCCEEECSSCEEECCSS-CCCTTTTTSSCCCCHHHHHHHHHHH
T ss_pred             HHHHHhCcccCcEEEECccchHHHHHHHHHhcCchhhhcceeeCCCceEEecCC-CChhhcCCCCccCcHHHHHHHHHHH
Confidence            499999999999999999999999999  9999999999999999999999999 9999999999999999999999999


Q ss_pred             hhcCcHHHHHHHHHHHHHHHHcCCcccCCCCCCCCHHHHHHHHHHhcC
Q psy9338          83 SHVNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANLK  130 (130)
Q Consensus        83 ~~lg~~~~A~~i~~Av~~~l~~g~~~T~DlgG~~tT~e~~~avi~~l~  130 (130)
                      +|||++++|++|++||.+++++|+++|+||||++||+||+++|+++|+
T Consensus       318 ~~lg~~~~A~~Ie~Av~~~l~~G~~~T~Dlgg~~~T~e~~daV~~~l~  365 (366)
T 3ty4_A          318 EFMGHQDAAADIYTAVDKVLTEGKVLTPDLGGKSGTNEITDAVLANIH  365 (366)
T ss_dssp             HHTTCHHHHHHHHHHHHHHHHHCSSCCGGGTSCCCHHHHHHHHHHHC-
T ss_pred             HHCCCHHHHHHHHHHHHHHHHcCCccCcccCCCcCHHHHHHHHHHHhh
Confidence            999999999999999999999998999999999999999999999885
>3blx_A Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_A 3blv_A* Back     alignment and structure
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosyn; 1.85A {Thermus thermophilus} PDB: 3asj_A* 3ah3_A Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Back     alignment and structure
>3udu_A 3-isopropylmalate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.85A {Campylobacter jejuni} SCOP: c.77.1.1 PDB: 3udo_A Back     alignment and structure
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Back     alignment and structure
>2y3z_A 3-isopropylmalate dehydrogenase; oxidoreductase, LEUB, leucine biosynthesis; HET: 2PE; 1.83A {Thermus thermophilus} PDB: 2y40_A 2y41_A* 2y42_A* 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1g2u_A 1gc9_A 1osj_A 1ipd_A 1gc8_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Back     alignment and structure
>3vmk_A 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase; HET: IPM; 1.48A {Shewanella benthica} PDB: 3vml_A* 3vmj_A* 3vl2_A* 3vkz_A* 3vl4_A* 3vl6_A* 3vl7_A* 3vl3_A* Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; struc genomics, seattle structural genomics center for infectious ssgcid, glyoxylate bypass, manganese; 1.65A {Burkholderia pseudomallei} SCOP: c.77.1.1 PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 3lcb_C* 4aj3_A* 4aja_A* 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A ... Back     alignment and structure
>3blx_B Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, oxidative metabolism, allostery, decarboxylase, allosteric enzyme, magnesium; 2.70A {Saccharomyces cerevisiae} PDB: 3blw_B* 3blv_B Back     alignment and structure
>3u1h_A 3-isopropylmalate dehydrogenase; oxidored; 2.80A {Bacillus SP} PDB: 2ayq_A 1v53_A 1v5b_A Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Acidithiobacillus ferrooxidans} SCOP: c.77.1.1 Back     alignment and structure
>3r8w_A 3-isopropylmalate dehydrogenase 2, chloroplastic; dimer, isocitrate and isopropylmalate dehydrogenases family, biosynthesis; 2.25A {Arabidopsis thaliana} Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics PSI, protein structure initiative, joint center for structu genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Back     alignment and structure
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus} Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Back     alignment and structure
>1w0d_A 3-isopropylmalate dehydrogenase; oxidoreductase, leucine biosynthesis, NAD, ST genomics, PSI, protein structure initiative; 1.65A {Mycobacterium tuberculosis} SCOP: c.77.1.1 PDB: 2g4o_A Back     alignment and structure
>2uxq_A Isocitrate dehydrogenase native; psychrophilic, cold adaptation, thermal stability, oxidoreductase; HET: SO4 PEG; 1.75A {Desulfotalea psychrophila} PDB: 2uxr_A* Back     alignment and structure
>1zor_A Isocitrate dehydrogenase; wild type enzyme, CIS-proline, thermostable, oxidoreductase; 2.24A {Thermotoga maritima} Back     alignment and structure
>3us8_A Isocitrate dehydrogenase [NADP]; PSI-biology, structural genomics; 2.25A {Sinorhizobium meliloti} Back     alignment and structure
>2qfy_A Isocitrate dehydrogenase [NADP]; rossmann fold, oxidoreductase; HET: AKG; 2.10A {Saccharomyces cerevisiae} PDB: 2qfw_A* 2qfx_A* 2qfv_A* Back     alignment and structure
>1lwd_A Isocitrate dehydrogenase; tricarboxylic acid cycle, oxidoreductase, NADP; HET: ICT; 1.85A {Sus scrofa} SCOP: c.77.1.1 PDB: 1t0l_A* 1t09_A* 3mas_B* 3map_A* 3mar_A* 3mas_A* 3inm_A* 2cmj_A* 2cmv_A* Back     alignment and structure
>4aoy_A Isocitrate dehydrogenase [NADP]; oxidoreductase, temperature adaptation, thermophilic, psychr NADP+ selectivity, domain movements; 2.35A {Clostridium thermocellum} PDB: 4aou_A Back     alignment and structure
>2b0t_A NADP isocitrate dehydrogenase; monomeric, IDH, oxidoreductase; 1.75A {Corynebacterium glutamicum} PDB: 3mbc_A* Back     alignment and structure
>1itw_A Isocitrate dehydrogenase; greece KEY motif, oxidoreductase; HET: ICT; 1.95A {Azotobacter vinelandii} SCOP: c.77.1.2 PDB: 1j1w_A* Back     alignment and structure
>4aty_A Terephthalate 1,2-CIS-dihydrodiol dehydrogenase; oxidoreductase; 1.85A {Burkholderia xenovorans LB400} Back     alignment and structure
>2hi1_A 4-hydroxythreonine-4-phosphate dehydrogenase 2; pyridoxal phosphate biosynthesis, structural GENO PSI-2, protein structure initiative; 2.30A {Salmonella typhimurium} Back     alignment and structure
>1yxo_A 4-hydroxythreonine-4-phosphate dehydrogenase 1; PA0593,pyridoxine biosynthesis,oxidoreductase, structural GE PSI; 2.01A {Pseudomonas aeruginosa} Back     alignment and structure
>3lxy_A 4-hydroxythreonine-4-phosphate dehydrogenase; PDXA, NAD-DEPE dehydrogenase, metal-binding, NAD, NADP, oxidoreductase, PY biosynthesis; HET: SUC; 1.70A {Yersinia pestis} SCOP: c.77.1.3 PDB: 1ps6_A* 1ptm_A 1ps7_A 1r8k_A Back     alignment and structure
>3tsn_A 4-hydroxythreonine-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: UNL; 2.63A {Campylobacter jejuni subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1g2ua_345 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 2e-24
d1pb1a_416 c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Esch 2e-24
d1hqsa_423 c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Baci 6e-23
d1a05a_357 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 2e-22
d1v53a1356 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase 3e-22
d1wpwa_336 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 2e-21
d1cnza_363 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 5e-19
d1t0la_414 c.77.1.1 (A:) NADP-dependent isocitrate dehydrogen 1e-18
d1w0da_337 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 1e-18
d1vlca_362 c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPM 1e-17
d1lwda_413 c.77.1.1 (A:) NADP-dependent isocitrate dehydrogen 5e-17
>d1g2ua_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} Length = 345 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: Dimeric isocitrate & isopropylmalate dehydrogenases
domain: 3-isopropylmalate dehydrogenase, IPMDH
species: Thermus thermophilus [TaxId: 274]

 Score = 93.3 bits (231), Expect = 2e-24
 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 33  LVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKMLSHV-NLQYYG 91
           L G  G++  AS      VFEP       +  GK +ANPTA +L +  ML H   L    
Sbjct: 250 LPGSLGLLPSASLGRGTPVFEPVHGS-APDIAGKGIANPTAAILSAAMMLEHAFGLVELA 308

Query: 92  DMIRNAVNRVLKAGKVRTKDLGGQSTTQEYTYAVIANL 129
             + +AV + L   +    DLGG + T+ +T  V+ +L
Sbjct: 309 RKVEDAVAKALL--ETPPPDLGGSAGTEAFTATVLRHL 344
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Length = 416 Back     information, alignment and structure
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} Length = 423 Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Length = 357 Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Length = 356 Back     information, alignment and structure
>d1wpwa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]} Length = 336 Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Length = 363 Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 414 Back     information, alignment and structure
>d1w0da_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]} Length = 337 Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Length = 362 Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 413 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1a05a_357 3-isopropylmalate dehydrogenase, IPMDH {Thiobacill 100.0
d1g2ua_345 3-isopropylmalate dehydrogenase, IPMDH {Thermus th 100.0
d1wpwa_336 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus 100.0
d1v53a1356 3-isopropylmalate dehydrogenase, IPMDH {Bacillus c 100.0
d1pb1a_416 Isocitrate dehydrogenase, ICDH {Escherichia coli [ 100.0
d1hqsa_423 Isocitrate dehydrogenase, ICDH {Bacillus subtilis 100.0
d1cnza_363 3-isopropylmalate dehydrogenase, IPMDH {Salmonella 100.0
d1vlca_362 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga 100.0
d1w0da_337 3-isopropylmalate dehydrogenase, IPMDH {Mycobacter 100.0
d1t0la_414 NADP-dependent isocitrate dehydrogenase {Human (Ho 100.0
d1lwda_413 NADP-dependent isocitrate dehydrogenase {Pig (Sus 100.0
d1itwa_740 Monomeric isocitrate dehydrogenase {Azotobacter vi 97.75
d1ptma_329 4-hydroxythreonine-4-phosphate dehydrogenase PdxA 97.51
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Isocitrate/Isopropylmalate dehydrogenase-like
superfamily: Isocitrate/Isopropylmalate dehydrogenase-like
family: Dimeric isocitrate & isopropylmalate dehydrogenases
domain: 3-isopropylmalate dehydrogenase, IPMDH
species: Thiobacillus ferrooxidans [TaxId: 920]

Probab=100.00  E-value=5e-53  Score=348.71  Aligned_cols=124  Identities=28%  Similarity=0.419  Sum_probs=120.6

Q ss_pred             cchhhhcCCCCceeeeCCcchhhhhhh--hhcccccccccccCCCCcceeccCCCCccccccCCcccChHHHHHHHHHHh
Q psy9338           5 ELDLKEDSKQLSAPSVKSKQNNIWLDL--RLVGGAGVVAGASWSPECVVFEPGARHTYSEAVGKNVANPTAMLLCSTKML   82 (130)
Q Consensus         5 ~~~lv~~P~~fdViv~~Nl~GDIlsd~--~l~Gg~Gl~ps~nig~~~~~fEp~h~GsapdiaGk~~ANP~a~ils~ammL   82 (130)
                      +||||++|++||||||+|||||||||+  +++||+|++||+|+|+++++|||+| ||||||+|||+|||+|+|||++|||
T Consensus       225 ~~~lv~~P~~fdViv~~Nl~GDIlSDl~a~l~GglGl~ps~nig~~~a~fE~~H-GsapdiaGk~~aNP~a~ils~ammL  303 (357)
T d1a05a_         225 AMQLIRAPAQFDVLLTGNMFGDILSDEASQLTGSIGMLPSASLGEGRAMYEPIH-GSAPDIAGQDKANPLATILSVAMML  303 (357)
T ss_dssp             HHHHHHCGGGCSEEEECHHHHHHHHHHHHHTTSCGGGCEEEEECSSCEEEEESS-CCCGGGTTTTCSCCHHHHHHHHHHH
T ss_pred             HHHHHhccccccEEechHHHHHHHHHHHHHHhcCcccccceeccCCcccccccc-CCCccccCCCccCcHHHHHHHHHHH
Confidence            499999999999999999999999999  9999999999999999999999999 9999999999999999999999999


Q ss_pred             hh-cCcHHHHHHHHHHHHHHHHcCCcccCCCCCCCC----HHHHHHHHHHhcC
Q psy9338          83 SH-VNLQYYGDMIRNAVNRVLKAGKVRTKDLGGQST----TQEYTYAVIANLK  130 (130)
Q Consensus        83 ~~-lg~~~~A~~i~~Av~~~l~~g~~~T~DlgG~~t----T~e~~~avi~~l~  130 (130)
                      || +|++++|++|++||.+++++| ++|+||||+.|    |+||+|+|+++|+
T Consensus       304 ~~~lg~~~~A~~i~~Av~~~i~~g-~~T~Dlgg~~t~~~~T~e~~daV~~~l~  355 (357)
T d1a05a_         304 RHSLNAEPWAQRVEAAVQRVLDQG-LRTADIAAPGTPVIGTKAMGAAVVNALN  355 (357)
T ss_dssp             HHTSSCHHHHHHHHHHHHHHHHTT-CCCGGGCCTTSCCCCHHHHHHHHHHTTT
T ss_pred             HhcCCCHHHHHHHHHHHHHHHHcC-CcCcccCCCCCCCcCHHHHHHHHHHHHc
Confidence            99 899999999999999999999 89999999875    9999999999985
>d1g2ua_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wpwa_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hqsa_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w0da_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1itwa_ c.77.1.2 (A:) Monomeric isocitrate dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ptma_ c.77.1.3 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure