Diaphorina citri psyllid: psy933

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWVY
cEEEEEcccccccccEEccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccEEEEEccccccHHHHHHHHHHHccccccccccccccccccccccccCEEECcHHHHHHHHHHccEEEEEEEccccccccHHHHHHHHHcccEEEEEccHHHHHHHccccccCEEEEEcccccccccccHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHccccccEEEccccccccHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHcccccCEEEcccc
MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTI********NC********L*KDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPV**************RAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWVY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWVY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peripheral plasma membrane protein CASK Multidomain scaffolding protein with a role in synaptic transmembrane protein anchoring and ion channel trafficking. Contributes to neural development and regulation of gene expression via interaction with the transcription factor TRB1. Binds to cell-surface proteins, including amyloid precursor protein, neurexins and syndecans. May mediate a link between the extracellular matrix and the actin cytoskeleton via its interaction with syndecan and with the actin/spectrin-binding protein 4.1.confidentO14936
Peripheral plasma membrane protein CASK Multidomain scaffolding protein with a role in synaptic transmembrane protein anchoring and ion channel trafficking. Contributes to neural development and regulation of gene expression via interaction with the transcription factor TRB1. Binds to cell-surface proteins, including amyloid precursor protein, neurexins, and syndecans. May mediate a link between the extracellular matrix and the actin cytoskeleton via its interaction with syndecan and with the actin/spectrin-binding protein 4.1.confidentO70589
Peripheral plasma membrane protein CASK May regulate transmembrane proteins that bind calcium, calmodulin, or nucleotides. Functionally modulates eag potassium channels; increases eag current and whole-cell conductance. Also regulates autophosphorylation of CaMKII.confidentQ24210

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046928 [BP]regulation of neurotransmitter secretionprobableGO:0032879, GO:0051046, GO:0060341, GO:0010646, GO:0051049, GO:0050794, GO:0008150, GO:0031644, GO:0044057, GO:0065007, GO:0051239, GO:0023051, GO:0051588, GO:0051969, GO:0050804, GO:0050789
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0005652 [CC]nuclear laminaprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0070160 [CC]occluding junctionprobableGO:0005575, GO:0030054, GO:0005911
GO:0007628 [BP]adult walking behaviorprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0008344, GO:0044699
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0061045 [BP]negative regulation of wound healingprobableGO:0032102, GO:0032101, GO:0080134, GO:0048583, GO:0050789, GO:0008150, GO:0061041, GO:0065007, GO:0048519, GO:0048585
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0008360 [BP]regulation of cell shapeprobableGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016363 [CC]nuclear matrixprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0090280 [BP]positive regulation of calcium ion importprobableGO:0010959, GO:0032879, GO:0051928, GO:0051049, GO:0051050, GO:0051924, GO:0050794, GO:0043270, GO:0048518, GO:0050789, GO:0065007, GO:0034762, GO:0008150, GO:0034764, GO:0034765, GO:0034767, GO:0090279, GO:0043269, GO:0048522
GO:0051649 [BP]establishment of localization in cellprobableGO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0090288 [BP]negative regulation of cellular response to growth factor stimulusprobableGO:0090287, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008049 [BP]male courtship behaviorprobableGO:0060179, GO:0044703, GO:0032501, GO:0032504, GO:0048609, GO:0007618, GO:0019098, GO:0007617, GO:0050896, GO:0007619, GO:0007610, GO:0022414, GO:0008150, GO:0044706, GO:0033057, GO:0000003, GO:0051705, GO:0051704
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0043296 [CC]apical junction complexprobableGO:0005575, GO:0030054, GO:0005911
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0016301 [MF]kinase activityprobableGO:0016772, GO:0016740, GO:0003674, GO:0003824
GO:0001953 [BP]negative regulation of cell-matrix adhesionprobableGO:0010810, GO:0030155, GO:0001952, GO:0050794, GO:0050789, GO:0007162, GO:0065007, GO:0008150, GO:0048519, GO:0010812, GO:0048523
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0060170 [CC]cilium membraneprobableGO:0043229, GO:0071944, GO:0005929, GO:0043227, GO:0043226, GO:0044446, GO:0031090, GO:0031514, GO:0016020, GO:0044459, GO:0031253, GO:0005886, GO:0042995, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044441, GO:0044424, GO:0044425, GO:0044422
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0030863 [CC]cortical cytoskeletonprobableGO:0005856, GO:0005737, GO:0043228, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0043226, GO:0044448
GO:0010839 [BP]negative regulation of keratinocyte proliferationprobableGO:0042127, GO:0008285, GO:0050678, GO:0050680, GO:0050794, GO:0008150, GO:0010837, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KGD, chain A
Confidence level:very confident
Coverage over the Query: 91-267
View the alignment between query and template
View the model in PyMOL
Template: 1KJW, chain A
Confidence level:very confident
Coverage over the Query: 1-42,55-56,68-277
View the alignment between query and template
View the model in PyMOL
Template: 3SHW, chain A
Confidence level:very confident
Coverage over the Query: 1-42,76-132,143-144,172-276
View the alignment between query and template
View the model in PyMOL
Template: 3KFV, chain A
Confidence level:very confident
Coverage over the Query: 277-326
View the alignment between query and template
View the model in PyMOL