Psyllid ID: psy933


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWVY
cEEEEEcccccccccEEccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccEEEEEccccccHHHHHHHHHHHccccccccccccccccccccccccEEEEEcHHHHHHHHHHccEEEEEEEccccccccHHHHHHHHHcccEEEEEccHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHcccccEEEEcccc
cEEEEEcccccHHHEEEcccccccEEcccHHHHHHHHHHHHccccccccccccccccccccccccEcccccccccHHHEEEEHHHHcccccccccEEEEccccccHHHHHHHHHHHHcccEEEcccEEcccccccccEcccEEEccHHHHHHHHHHccEEEEEEEccEEEEEEHHHHHHHHHcccEEEEEccHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHccccccEEEHHHEcccHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHccccccEEEEEEc
mfqiiskddhnwWQARKdnvagsaglipspelqEWRTACSTIdktkheqvncsifgrkkkLYKDKYLAKhnavfdqldlVTYEEVVKLPSFKRKTLVLLGAhgvgrrhikntlinkfpdkyaypvphttrsprsdeengrayyfiSHDEMMSDIAANQyleygthedamygtKLETIRRIHQEGKIAILDVEPQALKilrtgefspfvvfiaapqlqnlsdydGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEElhttpqwipvswLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEElhttpqwipvswvy
mfqiiskddhnwwQARKDNVAGSaglipspelQEWRTACStidktkheqvncsifgrkkKLYKDKYLAKHnavfdqldlVTYEEVVKLPSFKRKTLVllgahgvgrrhikntlinkfpdkyaypvphttrsprsdeenGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEelhttpqwipvswvy
MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRkkklykdkylakHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWVY
*********HNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPV**************RAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWV*
MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQ************************************************YEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPV***************AYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQ*********************AYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWVY
MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVP**********ENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWVY
MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTI********NC********L*KDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWVY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query330 2.2.26 [Sep-21-2011]
Q24210898 Peripheral plasma membran yes N/A 0.845 0.310 0.784 1e-137
O14936926 Peripheral plasma membran yes N/A 0.845 0.301 0.718 1e-116
O70589926 Peripheral plasma membran yes N/A 0.845 0.301 0.715 1e-116
Q62915909 Peripheral plasma membran yes N/A 0.830 0.301 0.693 1e-110
P54936961 Protein lin-2 OS=Caenorha no N/A 0.845 0.290 0.613 1e-105
Q00013466 55 kDa erythrocyte membra no N/A 0.830 0.587 0.546 2e-86
Q5RDW4466 55 kDa erythrocyte membra no N/A 0.830 0.587 0.546 2e-86
Q5ZJ00468 55 kDa erythrocyte membra no N/A 0.830 0.585 0.546 2e-86
A9CB74466 55 kDa erythrocyte membra N/A N/A 0.830 0.587 0.542 7e-86
P70290466 55 kDa erythrocyte membra no N/A 0.830 0.587 0.539 1e-85
>sp|Q24210|CSKP_DROME Peripheral plasma membrane protein CASK OS=Drosophila melanogaster GN=CASK PE=1 SV=4 Back     alignment and function desciption
 Score =  488 bits (1255), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 254/283 (89%), Gaps = 4/283 (1%)

Query: 1   MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKK 60
           + QIISKDDH+WWQAR D V GSAGLIPSPELQEWR AC T+DKTK EQVNCSIFGRKKK
Sbjct: 615 ILQIISKDDHHWWQARLDTVGGSAGLIPSPELQEWRIACQTVDKTKQEQVNCSIFGRKKK 674

Query: 61  LYKDKYLAKHNAVFDQLDLVTYEEVVKLP----SFKRKTLVLLGAHGVGRRHIKNTLINK 116
             +DKYLAKHNA+FD LD+VTYEEVVK+P    +F+RKTLVLLGAHGVGRRHIKNTLI+K
Sbjct: 675 QCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISK 734

Query: 117 FPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLET 176
           +PDKYAYP+PHTTR  + +EENGR+YYF+SHDEMM+DI AN+YLEYGTHEDAMYGTKL+T
Sbjct: 735 YPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDT 794

Query: 177 IRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDIL 236
           IRRIH EGK+AILDVEPQALKILRT EF+P+VVFIAAP LQN++DYDGSLE+LAKES++L
Sbjct: 795 IRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADYDGSLERLAKESEML 854

Query: 237 KSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWL 279
           +  Y HFFDLT+VNNDI ETI  LE AI+ +HTTPQW+PVSWL
Sbjct: 855 RQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWL 897




May regulate transmembrane proteins that bind calcium, calmodulin, or nucleotides. Functionally modulates eag potassium channels; increases eag current and whole-cell conductance. Also regulates autophosphorylation of CaMKII.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1EC: 7
>sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 Back     alignment and function description
>sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 Back     alignment and function description
>sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 Back     alignment and function description
>sp|P54936|LIN2_CAEEL Protein lin-2 OS=Caenorhabditis elegans GN=lin-2 PE=1 SV=1 Back     alignment and function description
>sp|Q00013|EM55_HUMAN 55 kDa erythrocyte membrane protein OS=Homo sapiens GN=MPP1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RDW4|EM55_PONAB 55 kDa erythrocyte membrane protein OS=Pongo abelii GN=MPP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJ00|EM55_CHICK 55 kDa erythrocyte membrane protein OS=Gallus gallus GN=MPP1 PE=2 SV=1 Back     alignment and function description
>sp|A9CB74|EM55_PAPAN 55 kDa erythrocyte membrane protein OS=Papio anubis GN=MPP1 PE=3 SV=1 Back     alignment and function description
>sp|P70290|EM55_MOUSE 55 kDa erythrocyte membrane protein OS=Mus musculus GN=Mpp1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
189235646 893 PREDICTED: similar to AGAP001683-PA [Tri 0.845 0.312 0.816 1e-140
270003442 966 hypothetical protein TcasGA2_TC002673 [T 0.845 0.288 0.816 1e-140
307171984407 Calcium/calmodulin-dependent protein kin 0.845 0.685 0.811 1e-138
322798021312 hypothetical protein SINV_08073 [Solenop 0.845 0.894 0.811 1e-138
195400208 1039 GJ14160 [Drosophila virilis] gi|19414227 0.845 0.268 0.791 1e-136
195453154 608 GK13019 [Drosophila willistoni] gi|19416 0.845 0.458 0.791 1e-136
194742992 1169 GF16967 [Drosophila ananassae] gi|190627 0.845 0.238 0.791 1e-136
345490096 919 PREDICTED: peripheral plasma membrane pr 0.845 0.303 0.793 1e-136
345490094 905 PREDICTED: peripheral plasma membrane pr 0.845 0.308 0.793 1e-136
195110523 594 GI22862 [Drosophila mojavensis] gi|19391 0.845 0.469 0.787 1e-135
>gi|189235646|ref|XP_968349.2| PREDICTED: similar to AGAP001683-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/283 (81%), Positives = 260/283 (91%), Gaps = 4/283 (1%)

Query: 1   MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKK 60
           + QIISKDDH+WWQARKDN AGSAGLIPSPELQEWR AC+ ++KTK EQVNCSIFGRKKK
Sbjct: 610 ILQIISKDDHHWWQARKDNSAGSAGLIPSPELQEWRAACAAMEKTKQEQVNCSIFGRKKK 669

Query: 61  LYKDKYLAKHNAVFDQLDLVTYEEVVKLP----SFKRKTLVLLGAHGVGRRHIKNTLINK 116
            YKDKYLAKHNAVFDQLDLVTYEEVVKLP    +F+RKTLVLLGAHGVGRRHIKNTLI K
Sbjct: 670 QYKDKYLAKHNAVFDQLDLVTYEEVVKLPMTDPAFQRKTLVLLGAHGVGRRHIKNTLIAK 729

Query: 117 FPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLET 176
            PD+YAYP+PHTTR PR+DEENGR Y+F+SHDEMM+DIAAN+YLEYGTHEDAMYGTKL+T
Sbjct: 730 HPDQYAYPIPHTTRQPRADEENGRNYFFVSHDEMMADIAANEYLEYGTHEDAMYGTKLDT 789

Query: 177 IRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDIL 236
           IR+IHQEGK+AILDVEPQALK+LRT EFSP+VVFIAAP LQN++DYDGSLE+LAKESD+L
Sbjct: 790 IRKIHQEGKMAILDVEPQALKVLRTAEFSPYVVFIAAPALQNIADYDGSLERLAKESDML 849

Query: 237 KSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWL 279
           + AY H+FDLT+VNNDI+ETI  LE AIE + TTPQWIPVSW+
Sbjct: 850 RQAYGHYFDLTIVNNDIDETIAALEAAIERVQTTPQWIPVSWV 892




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270003442|gb|EEZ99889.1| hypothetical protein TcasGA2_TC002673 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307171984|gb|EFN63593.1| Calcium/calmodulin-dependent protein kinase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322798021|gb|EFZ19865.1| hypothetical protein SINV_08073 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|195400208|ref|XP_002058710.1| GJ14160 [Drosophila virilis] gi|194142270|gb|EDW58678.1| GJ14160 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195453154|ref|XP_002073662.1| GK13019 [Drosophila willistoni] gi|194169747|gb|EDW84648.1| GK13019 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194742992|ref|XP_001953984.1| GF16967 [Drosophila ananassae] gi|190627021|gb|EDV42545.1| GF16967 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|345490096|ref|XP_003426296.1| PREDICTED: peripheral plasma membrane protein CASK-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345490094|ref|XP_001602666.2| PREDICTED: peripheral plasma membrane protein CASK-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195110523|ref|XP_001999829.1| GI22862 [Drosophila mojavensis] gi|193916423|gb|EDW15290.1| GI22862 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
FB|FBgn0013759898 CASK "CASK ortholog" [Drosophi 0.845 0.310 0.752 2.6e-118
UNIPROTKB|A5D7B9908 CASK "CASK protein" [Bos tauru 0.845 0.307 0.679 2.8e-105
UNIPROTKB|J9NZ27897 CASK "Uncharacterized protein" 0.845 0.311 0.679 5.8e-105
UNIPROTKB|O14936926 CASK "Peripheral plasma membra 0.845 0.301 0.679 5.8e-105
UNIPROTKB|F1RX15799 CASK "Uncharacterized protein" 0.845 0.349 0.679 5.8e-105
UNIPROTKB|K7GSB2908 CASK "Uncharacterized protein" 0.845 0.307 0.679 5.8e-105
MGI|MGI:1309489926 Cask "calcium/calmodulin-depen 0.845 0.301 0.676 7.5e-105
UNIPROTKB|D4A8M2920 Cask "Peripheral plasma membra 0.845 0.303 0.672 2e-104
UNIPROTKB|E1BWL4920 CASK "Uncharacterized protein" 0.845 0.303 0.676 8.6e-104
UNIPROTKB|E2RLG1921 CASK "Uncharacterized protein" 0.830 0.297 0.661 1.7e-100
FB|FBgn0013759 CASK "CASK ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1165 (415.2 bits), Expect = 2.6e-118, P = 2.6e-118
 Identities = 213/283 (75%), Positives = 244/283 (86%)

Query:     1 MFQIISKDDHNWWQARKDNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRXXX 60
             + QIISKDDH+WWQAR D V GSAGLIPSPELQEWR AC T+DKTK EQVNCSIFGR   
Sbjct:   615 ILQIISKDDHHWWQARLDTVGGSAGLIPSPELQEWRIACQTVDKTKQEQVNCSIFGRKKK 674

Query:    61 XXXXXXXXXHNAVFDQLDLVTYEEVVKLP----SFKRKTLVLLGAHGVGRRHIKNTLINK 116
                      HNA+FD LD+VTYEEVVK+P    +F+RKTLVLLGAHGVGRRHIKNTLI+K
Sbjct:   675 QCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDPNFQRKTLVLLGAHGVGRRHIKNTLISK 734

Query:   117 FPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAANQYLEYGTHEDAMYGTKLET 176
             +PDKYAYP+PHTTR  + +EENGR+YYF+SHDEMM+DI AN+YLEYGTHEDAMYGTKL+T
Sbjct:   735 YPDKYAYPIPHTTRPAKPEEENGRSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDT 794

Query:   177 IRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDIL 236
             IRRIH EGK+AILDVEPQALKILRT EF+P+VVFIAAP LQN++DYDGSLE+LAKES++L
Sbjct:   795 IRRIHTEGKMAILDVEPQALKILRTAEFTPYVVFIAAPSLQNIADYDGSLERLAKESEML 854

Query:   237 KSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSWL 279
             +  Y HFFDLT+VNNDI ETI  LE AI+ +HTTPQW+PVSWL
Sbjct:   855 RQLYGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWL 897


GO:0007628 "adult walking behavior" evidence=IMP
GO:0005954 "calcium- and calmodulin-dependent protein kinase complex" evidence=ISS
GO:0004683 "calmodulin-dependent protein kinase activity" evidence=ISS;IDA
GO:0016080 "synaptic vesicle targeting" evidence=NAS
GO:0007269 "neurotransmitter secretion" evidence=NAS
GO:0016081 "synaptic vesicle docking involved in exocytosis" evidence=NAS
GO:0004674 "protein serine/threonine kinase activity" evidence=NAS
GO:0006468 "protein phosphorylation" evidence=IEA;NAS
GO:0007163 "establishment or maintenance of cell polarity" evidence=NAS
GO:0007155 "cell adhesion" evidence=IMP
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0046928 "regulation of neurotransmitter secretion" evidence=IDA
GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0008049 "male courtship behavior" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|A5D7B9 CASK "CASK protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ27 CASK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O14936 CASK "Peripheral plasma membrane protein CASK" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RX15 CASK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GSB2 CASK "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1309489 Cask "calcium/calmodulin-dependent serine protein kinase (MAGUK family)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A8M2 Cask "Peripheral plasma membrane protein CASK" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWL4 CASK "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLG1 CASK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O14936CSKP_HUMAN2, ., 7, ., 1, 1, ., 10.71880.84540.3012yesN/A
Q62915CSKP_RAT2, ., 7, ., 1, 1, ., 10.69390.83030.3014yesN/A
Q24210CSKP_DROME2, ., 7, ., 1, 1, ., 1, 70.78440.84540.3106yesN/A
O70589CSKP_MOUSE2, ., 7, ., 1, 1, ., 10.71530.84540.3012yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 2e-66
smart00072174 smart00072, GuKc, Guanylate kinase homologues 1e-53
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMP 1e-28
TIGR03263179 TIGR03263, guanyl_kin, guanylate kinase 2e-26
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transpo 9e-26
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 6e-22
PLN02772398 PLN02772, PLN02772, guanylate kinase 2e-21
PRK14737186 PRK14737, gmk, guanylate kinase; Provisional 3e-15
cd1208162 cd12081, SH3_CASK, Src Homology 3 domain of Calciu 7e-13
cd1203562 cd12035, SH3_MPP1-like, Src Homology 3 domain of M 2e-12
cd1208062 cd12080, SH3_MPP1, Src Homology 3 domain of Membra 2e-09
cd1186261 cd11862, SH3_MPP, Src Homology 3 domain of Membran 3e-09
PRK14738206 PRK14738, gmk, guanylate kinase; Provisional 2e-07
cd1203759 cd12037, SH3_MPP2, Src Homology 3 domain of Membra 2e-04
cd1203861 cd12038, SH3_MPP6, Src Homology 3 domain of Membra 3e-04
cd1203461 cd12034, SH3_MPP4, Src Homology 3 domain of Membra 5e-04
cd1203663 cd12036, SH3_MPP5, Src Homology 3 domain of Membra 6e-04
cd1203361 cd12033, SH3_MPP7, Src Homology 3 domain of Membra 0.003
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
 Score =  206 bits (526), Expect = 2e-66
 Identities = 73/183 (39%), Positives = 110/183 (60%), Gaps = 7/183 (3%)

Query: 92  KRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMM 151
           +R+ +VL G  GVG+ HIK  L++++P+K+ Y V HTTR PR  E +G+ Y+F+S +EM 
Sbjct: 1   QRRPIVLSGPSGVGKSHIKKALLDEYPEKFGYSVSHTTRPPRPGEVDGKDYHFVSKEEME 60

Query: 152 SDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFI 211
           +DI+AN++LEY       YGT  E I +I + GKI ILDV+ Q +K LR  E SP  VFI
Sbjct: 61  NDISANEFLEYAEFNGNYYGTSKEAIEQIAESGKICILDVDIQGVKQLRKAELSPISVFI 120

Query: 212 AAPQLQNL-----SDYDGSLEKLAKESDILKSAYEHF--FDLTVVNNDIEETIGILEKAI 264
             P L+ L            EK+ K  +  +  ++H+  FD  +VN+D++E    L++ +
Sbjct: 121 KPPSLKVLQRRLKRRGTEQEEKINKRMEAAEQEFQHYALFDYIIVNDDLDEAYKKLKEIL 180

Query: 265 EEL 267
           E  
Sbjct: 181 EAE 183


Length = 183

>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|238026 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|213788 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information
>gnl|CDD|223272 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|234719 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|213014 cd12081, SH3_CASK, Src Homology 3 domain of Calcium/calmodulin-dependent Serine protein Kinase Back     alignment and domain information
>gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1)-like proteins Back     alignment and domain information
>gnl|CDD|213013 cd12080, SH3_MPP1, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1) Back     alignment and domain information
>gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins Back     alignment and domain information
>gnl|CDD|237809 PRK14738, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|212970 cd12037, SH3_MPP2, Src Homology 3 domain of Membrane Protein, Palmitoylated 2 (or MAGUK p55 subfamily member 2) Back     alignment and domain information
>gnl|CDD|212971 cd12038, SH3_MPP6, Src Homology 3 domain of Membrane Protein, Palmitoylated 6 (or MAGUK p55 subfamily member 6) Back     alignment and domain information
>gnl|CDD|212967 cd12034, SH3_MPP4, Src Homology 3 domain of Membrane Protein, Palmitoylated 4 (or MAGUK p55 subfamily member 4) Back     alignment and domain information
>gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) Back     alignment and domain information
>gnl|CDD|212966 cd12033, SH3_MPP7, Src Homology 3 domain of Membrane Protein, Palmitoylated 7 (or MAGUK p55 subfamily member 7) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 330
KOG0609|consensus542 100.0
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 100.0
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 100.0
PRK14737186 gmk guanylate kinase; Provisional 100.0
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 100.0
PLN02772398 guanylate kinase 100.0
KOG0708|consensus359 100.0
PRK14738206 gmk guanylate kinase; Provisional 100.0
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 100.0
KOG0707|consensus231 100.0
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.97
PRK00300205 gmk guanylate kinase; Provisional 99.97
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.83
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 99.82
PRK08356195 hypothetical protein; Provisional 99.79
COG3709192 Uncharacterized component of phosphonate metabolis 99.71
KOG3580|consensus 1027 99.7
KOG3812|consensus475 99.51
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 99.44
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 99.21
KOG0609|consensus542 99.13
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 99.12
PRK04040188 adenylate kinase; Provisional 98.98
PLN02840 421 tRNA dimethylallyltransferase 98.93
PRK00698205 tmk thymidylate kinase; Validated 98.89
PRK06762166 hypothetical protein; Provisional 98.77
PRK00098298 GTPase RsgA; Reviewed 98.68
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 98.66
PRK05057172 aroK shikimate kinase I; Reviewed 98.63
PRK00131175 aroK shikimate kinase; Reviewed 98.63
PLN02748 468 tRNA dimethylallyltransferase 98.6
COG0703172 AroK Shikimate kinase [Amino acid transport and me 98.59
PRK13946184 shikimate kinase; Provisional 98.53
PLN02165334 adenylate isopentenyltransferase 98.48
PRK13947171 shikimate kinase; Provisional 98.43
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 98.42
PRK13948182 shikimate kinase; Provisional 98.4
PRK04182180 cytidylate kinase; Provisional 98.39
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 98.38
PRK00889175 adenylylsulfate kinase; Provisional 98.34
PRK01184184 hypothetical protein; Provisional 98.32
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 98.31
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.3
PRK14530215 adenylate kinase; Provisional 98.29
PRK08233182 hypothetical protein; Provisional 98.28
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 98.27
PHA02530300 pseT polynucleotide kinase; Provisional 98.27
PRK05541176 adenylylsulfate kinase; Provisional 98.25
KOG1384|consensus 348 98.24
PRK13949169 shikimate kinase; Provisional 98.18
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.18
PRK03731171 aroL shikimate kinase II; Reviewed 98.16
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.14
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 98.12
PRK03846198 adenylylsulfate kinase; Provisional 98.11
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.11
PRK05480209 uridine/cytidine kinase; Provisional 98.11
PRK00081194 coaE dephospho-CoA kinase; Reviewed 98.1
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 98.08
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.08
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.06
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 98.0
PRK14532188 adenylate kinase; Provisional 98.0
PRK03839180 putative kinase; Provisional 97.98
PRK06696223 uridine kinase; Validated 97.98
PLN02200234 adenylate kinase family protein 97.97
PRK12339197 2-phosphoglycerate kinase; Provisional 97.97
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.94
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.94
PRK14531183 adenylate kinase; Provisional 97.9
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 97.9
PRK00625173 shikimate kinase; Provisional 97.89
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 97.89
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.88
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 97.85
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 97.85
PLN02924220 thymidylate kinase 97.84
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 97.8
PRK13975196 thymidylate kinase; Provisional 97.79
PLN02199303 shikimate kinase 97.78
PRK12298390 obgE GTPase CgtA; Reviewed 97.77
PRK14731208 coaE dephospho-CoA kinase; Provisional 97.77
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.76
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.75
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 97.74
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.74
PRK13976209 thymidylate kinase; Provisional 97.71
TIGR00436270 era GTP-binding protein Era. Era is an essential G 97.69
PRK14730195 coaE dephospho-CoA kinase; Provisional 97.68
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 97.68
PRK14527191 adenylate kinase; Provisional 97.67
PTZ002651466 multidrug resistance protein (mdr1); Provisional 97.66
COG1162301 Predicted GTPases [General function prediction onl 97.65
cd01896233 DRG The developmentally regulated GTP-binding prot 97.65
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.64
PRK14732196 coaE dephospho-CoA kinase; Provisional 97.63
PRK07261171 topology modulation protein; Provisional 97.63
KOG0058|consensus716 97.62
COG4619223 ABC-type uncharacterized transport system, ATPase 97.6
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 97.59
PRK04220301 2-phosphoglycerate kinase; Provisional 97.59
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 97.57
PRK14733204 coaE dephospho-CoA kinase; Provisional 97.57
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.55
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 97.54
PRK08099399 bifunctional DNA-binding transcriptional repressor 97.54
COG3842352 PotA ABC-type spermidine/putrescine transport syst 97.53
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.53
PRK00279215 adk adenylate kinase; Reviewed 97.5
PTZ00451244 dephospho-CoA kinase; Provisional 97.5
COG1160444 Predicted GTPases [General function prediction onl 97.49
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.49
PRK06761282 hypothetical protein; Provisional 97.49
COG4639168 Predicted kinase [General function prediction only 97.49
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 97.47
KOG3354|consensus191 97.47
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.46
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 97.46
COG0486454 ThdF Predicted GTPase [General function prediction 97.46
PLN02422232 dephospho-CoA kinase 97.46
PRK00089292 era GTPase Era; Reviewed 97.46
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.45
PRK06217183 hypothetical protein; Validated 97.45
KOG1191|consensus531 97.43
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 97.41
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 97.41
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 97.4
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.39
COG4988559 CydD ABC-type transport system involved in cytochr 97.38
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 97.38
PRK13973213 thymidylate kinase; Provisional 97.37
PRK12338319 hypothetical protein; Provisional 97.37
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 97.34
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.33
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.32
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 97.31
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.31
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.3
PRK03003472 GTP-binding protein Der; Reviewed 97.3
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.29
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.28
PRK13808333 adenylate kinase; Provisional 97.28
PRK14734200 coaE dephospho-CoA kinase; Provisional 97.28
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.27
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 97.27
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 97.27
PRK10790592 putative multidrug transporter membrane\ATP-bindin 97.27
PRK12288347 GTPase RsgA; Reviewed 97.25
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 97.25
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.25
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 97.23
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 97.23
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.23
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 97.22
KOG0057|consensus591 97.22
PRK02496184 adk adenylate kinase; Provisional 97.22
cd04171164 SelB SelB subfamily. SelB is an elongation factor 97.21
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.2
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.19
PRK00023225 cmk cytidylate kinase; Provisional 97.17
PRK09825176 idnK D-gluconate kinase; Provisional 97.16
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.15
COG1159298 Era GTPase [General function prediction only] 97.15
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 97.14
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 97.12
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 97.12
KOG0056|consensus790 97.12
COG1160 444 Predicted GTPases [General function prediction onl 97.11
COG0218200 Predicted GTPase [General function prediction only 97.11
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 97.11
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 97.1
KOG0055|consensus1228 97.1
PRK07933213 thymidylate kinase; Validated 97.1
PRK10789569 putative multidrug transporter membrane\ATP-bindin 97.09
PF00004132 AAA: ATPase family associated with various cellula 97.08
COG1163365 DRG Predicted GTPase [General function prediction 97.08
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 97.07
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 97.07
PRK14526211 adenylate kinase; Provisional 97.07
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.06
PRK00093435 GTP-binding protein Der; Reviewed 97.05
PRK12297424 obgE GTPase CgtA; Reviewed 97.04
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 97.04
cd01881176 Obg_like The Obg-like subfamily consists of five w 97.03
PRK12337475 2-phosphoglycerate kinase; Provisional 97.02
PRK13974212 thymidylate kinase; Provisional 97.02
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 97.02
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 97.01
PRK12296 500 obgE GTPase CgtA; Reviewed 97.01
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 96.99
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 96.99
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.99
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.99
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 96.98
PRK15494339 era GTPase Era; Provisional 96.97
PLN02318 656 phosphoribulokinase/uridine kinase 96.96
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 96.96
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 96.95
PRK08118167 topology modulation protein; Reviewed 96.93
PLN032321495 ABC transporter C family member; Provisional 96.92
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 96.91
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 96.91
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 96.9
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 96.89
COG1126240 GlnQ ABC-type polar amino acid transport system, A 96.88
smart00382148 AAA ATPases associated with a variety of cellular 96.88
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.88
PRK00454196 engB GTP-binding protein YsxC; Reviewed 96.88
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 96.88
PRK09087226 hypothetical protein; Validated 96.88
PLN02674244 adenylate kinase 96.87
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 96.87
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.87
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 96.85
PRK12289352 GTPase RsgA; Reviewed 96.85
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.85
PRK10522547 multidrug transporter membrane component/ATP-bindi 96.84
PRK12299335 obgE GTPase CgtA; Reviewed 96.84
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 96.83
KOG0055|consensus 1228 96.83
PLN03130 1622 ABC transporter C family member; Provisional 96.82
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 96.8
COG1084346 Predicted GTPase [General function prediction only 96.79
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 96.79
cd04105203 SR_beta Signal recognition particle receptor, beta 96.79
KOG1489|consensus366 96.78
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 96.78
KOG0708|consensus359 96.75
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 96.75
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 96.75
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 96.74
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 96.74
COG1127263 Ttg2A ABC-type transport system involved in resist 96.73
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 96.72
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.7
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 96.69
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 96.69
PRK09435332 membrane ATPase/protein kinase; Provisional 96.69
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 96.67
COG3638258 ABC-type phosphate/phosphonate transport system, A 96.64
cd00881189 GTP_translation_factor GTP translation factor fami 96.64
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 96.64
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.63
PRK00093 435 GTP-binding protein Der; Reviewed 96.62
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 96.62
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 96.6
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.59
PRK06547172 hypothetical protein; Provisional 96.58
COG1117253 PstB ABC-type phosphate transport system, ATPase c 96.58
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.56
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.55
PTZ00301210 uridine kinase; Provisional 96.54
PTZ002431560 ABC transporter; Provisional 96.53
smart00178184 SAR Sar1p-like members of the Ras-family of small 96.53
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.52
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 96.5
KOG3079|consensus195 96.5
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 96.5
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.5
PRK04213201 GTP-binding protein; Provisional 96.49
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 96.49
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 96.47
cd03115173 SRP The signal recognition particle (SRP) mediates 96.46
PRK14529223 adenylate kinase; Provisional 96.43
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 96.42
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 96.42
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 96.39
COG4987573 CydC ABC-type transport system involved in cytochr 96.39
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 96.37
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 96.36
PF00005137 ABC_tran: ABC transporter This structure is on hol 96.35
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.34
PF13173128 AAA_14: AAA domain 96.34
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.34
PLN03110216 Rab GTPase; Provisional 96.33
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 96.33
PF1355562 AAA_29: P-loop containing region of AAA domain 96.32
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.31
PRK10865 857 protein disaggregation chaperone; Provisional 96.31
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.3
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 96.29
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.29
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.29
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 96.29
cd01878204 HflX HflX subfamily. A distinct conserved domain w 96.28
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.28
COG1100219 GTPase SAR1 and related small G proteins [General 96.27
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.26
PRK06620214 hypothetical protein; Validated 96.25
PRK14737186 gmk guanylate kinase; Provisional 96.25
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.25
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 96.24
cd00154159 Rab Rab family. Rab GTPases form the largest famil 96.22
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 96.22
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 96.22
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.21
CHL00181287 cbbX CbbX; Provisional 96.2
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.19
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 96.18
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.18
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 96.17
PLN02842 505 nucleotide kinase 96.17
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 96.17
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 96.17
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 96.16
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 96.16
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 96.16
PRK09270229 nucleoside triphosphate hydrolase domain-containin 96.15
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 96.15
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 96.15
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 96.14
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 96.14
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 96.14
PF05729166 NACHT: NACHT domain 96.13
PTZ00088229 adenylate kinase 1; Provisional 96.13
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 96.13
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 96.13
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 96.13
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.13
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 96.13
PLN02772398 guanylate kinase 96.11
cd00876160 Ras Ras family. The Ras family of the Ras superfam 96.1
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 96.1
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 96.1
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 96.1
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.09
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.08
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 96.08
COG2884223 FtsE Predicted ATPase involved in cell division [C 96.08
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 96.08
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 96.07
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 96.07
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 96.04
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 96.04
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 96.03
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 96.03
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 96.03
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 96.03
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 96.02
KOG0734|consensus 752 96.02
cd03269210 ABC_putative_ATPase This subfamily is involved in 96.02
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 96.02
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 96.01
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 96.01
PRK14528186 adenylate kinase; Provisional 96.0
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 95.99
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 95.99
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 95.98
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 95.98
TIGR00231161 small_GTP small GTP-binding protein domain. This m 95.97
COG0536369 Obg Predicted GTPase [General function prediction 95.97
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 95.96
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 95.96
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 95.96
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 95.96
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 95.96
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 95.95
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 95.94
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 95.94
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 95.94
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 95.94
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 95.94
PLN02459261 probable adenylate kinase 95.94
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 95.93
KOG3347|consensus176 95.92
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 95.92
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.92
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 95.92
COG4525259 TauB ABC-type taurine transport system, ATPase com 95.9
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 95.9
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 95.9
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 95.89
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 95.88
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 95.88
PTZ00258 390 GTP-binding protein; Provisional 95.88
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 95.88
PRK03003 472 GTP-binding protein Der; Reviewed 95.87
PRK15453290 phosphoribulokinase; Provisional 95.87
KOG3877|consensus393 95.87
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.86
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 95.86
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 95.86
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.85
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 95.85
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 95.85
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 95.85
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 95.84
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.84
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 95.84
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 95.83
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 95.83
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 95.83
PRK13796365 GTPase YqeH; Provisional 95.83
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 95.83
cd03246173 ABCC_Protease_Secretion This family represents the 95.82
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 95.82
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 95.82
cd03234226 ABCG_White The White subfamily represents ABC tran 95.82
PRK10908222 cell division protein FtsE; Provisional 95.82
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 95.8
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 95.8
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 95.8
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 95.79
PF09439181 SRPRB: Signal recognition particle receptor beta s 95.79
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 95.79
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 95.79
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 95.79
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 95.79
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 95.79
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 95.78
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 95.78
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 95.78
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.78
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 95.77
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.77
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 95.77
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 95.77
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 95.76
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.76
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.76
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.75
COG1123539 ATPase components of various ABC-type transport sy 95.75
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 95.75
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.75
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.74
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 95.74
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 95.73
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 95.73
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 95.73
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.73
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 95.73
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.72
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 95.72
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 95.72
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 95.72
COG4181228 Predicted ABC-type transport system involved in ly 95.71
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 95.71
cd03215182 ABC_Carb_Monos_II This family represents domain II 95.71
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.71
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 95.71
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 95.7
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 95.7
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 95.7
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 95.69
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 95.69
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 95.69
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 95.68
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 95.68
PRK07667193 uridine kinase; Provisional 95.68
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 95.68
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 95.67
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 95.67
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 95.67
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 95.67
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 95.67
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 95.67
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 95.66
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 95.66
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 95.66
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 95.66
PRK13536340 nodulation factor exporter subunit NodI; Provision 95.65
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 95.64
CHL00195489 ycf46 Ycf46; Provisional 95.63
COG4161242 ArtP ABC-type arginine transport system, ATPase co 95.63
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 95.63
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 95.63
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 95.63
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 95.63
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 95.63
PRK14242253 phosphate transporter ATP-binding protein; Provisi 95.62
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 95.61
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 95.61
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 95.6
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 95.59
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 95.59
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 95.59
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 95.59
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.59
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 95.59
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 95.57
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 95.57
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.56
COG4185187 Uncharacterized protein conserved in bacteria [Fun 95.56
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 95.55
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 95.55
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 95.55
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.55
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.55
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 95.54
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 95.53
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 95.53
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 95.53
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 95.53
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 95.53
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 95.52
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 95.52
PRK13537306 nodulation ABC transporter NodI; Provisional 95.52
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 95.51
PRK12377248 putative replication protein; Provisional 95.51
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 95.51
>KOG0609|consensus Back     alignment and domain information
Probab=100.00  E-value=9.4e-84  Score=630.30  Aligned_cols=294  Identities=52%  Similarity=0.903  Sum_probs=262.3

Q ss_pred             CcEEEeCCCCCceeEEeCC--CCCCceeeCChhHHHHHHhhccccccccc-cccccccccccccccchhhhccccccCCc
Q psy933            1 MFQIISKDDHNWWQARKDN--VAGSAGLIPSPELQEWRTACSTIDKTKHE-QVNCSIFGRKKKLYKDKYLAKHNAVFDQL   77 (330)
Q Consensus         1 iL~v~~~~D~~WWQA~~~~--~~~~~GlIPS~~~~e~r~~~~~~~~~~~~-~~~~~~~~rk~k~~~~~~~~~~~~~~~~~   77 (330)
                      ||||+||+|+|||||++.+  .++.||||||+.+||||.++...+.++.. ...|.+++||+|.++.+|+.++++.++..
T Consensus       245 ILqIv~qdD~nWWQA~~~~~~~~~~AGLiPS~~~qerr~a~~~~~~~~~~~~~~c~~l~kkkk~~~~~y~~~~~~~~d~~  324 (542)
T KOG0609|consen  245 ILQIVSQDDPNWWQARRVGDPFGGLAGLIPSKELQERRVACLRREVSKEPEKTRCQRLSKKKKKKKSKYLGKHSAVFDQP  324 (542)
T ss_pred             eeeeccCCCcchhhhhcccCccccccccccCHHHHHHHHHHHhhhcccCCcCchhcccchhhhhhhhhhhhhcchhhhcc
Confidence            8999999999999999977  57999999999999999999877655332 34788888888877788999999999999


Q ss_pred             cccCceeeecccCCCCCEEEEEcCCCccHHHHHHHHHhhCCCCccccccccccCCCCcccCCeeEEEecccchhhHHhcc
Q psy933           78 DLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMSDIAAN  157 (330)
Q Consensus        78 ~~~~Ye~V~~~~~~~~r~ivLvGpsGvGKstL~~~L~~~~p~~f~~~v~~TTR~pr~~E~~G~dy~fvs~~~f~~~i~~~  157 (330)
                      +.++||||++|+++++|++||+||.|||...|.++|+..+|++|+.+||||||+||++|++|++|||||+++|++++.+|
T Consensus       325 ~~~tYEEV~~~~~~~rrtlVLiGa~GvGr~elk~~Li~~~p~~f~~~VPhTtR~~r~~E~dG~eY~FVSk~~~e~dI~~~  404 (542)
T KOG0609|consen  325 ELLTYEEVVRYPPFRRRTLVLIGAQGVGRRELKNKLIELNPDRFGTAVPHTTRPPRSDEVDGVEYHFVSKEEMEADIRAG  404 (542)
T ss_pred             ccccHHHHhhhcccccceEEEECCcccchHHHHHHHHhhCccccccCCCCcCCCCCCCCCCCccceeeehHHHhhhhhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeEEeecCccccccHHHHHHHHHhCCeEEEEeCHHHHHHHHhcCCCCEEEEEccCccccccCchHHHHHHHHHHHHHH
Q psy933          158 QYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDGSLEKLAKESDILK  237 (330)
Q Consensus       158 ~fle~~~~~g~~YGts~~~i~~v~~~gk~~vldv~~~~v~~L~~~~~~p~vIfI~pps~~~l~~~~e~~~rl~~~~~~ie  237 (330)
                      +|+|||+|.+|+|||++++|+.++++||+||||+.|++++.||+++|+||||||+||+++.++..       .+. .   
T Consensus       405 ~~lE~GEy~~nlYGTs~dsVr~v~~~gKicvLdv~Pqalk~lRt~Ef~PyVIFI~pP~~~~~r~~-------r~~-~---  473 (542)
T KOG0609|consen  405 KFLEYGEYEGNLYGTSLDSVRNVIASGKICVLDVEPQALKVLRTAEFKPYVIFIAPPSLEELRAL-------RKV-A---  473 (542)
T ss_pred             CceecCcchhccccchHHHHHHHHHhCCEEEEecCHHHhhhhhhhcccceEEEecCCCchhHHHH-------hhh-c---
Confidence            99999999999999999999999999999999999999999999999999999999998765321       111 1   


Q ss_pred             hhccccceEEEecC-CHHHHHHHHHHHHHHhcCCCccccccccccchhhhhhhccceeeEEEEcCCHHHHHHHHHHHHHH
Q psy933          238 SAYEHFFDLTVVNN-DIEETIGILEKAIEELHTTPQWIPVSWLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEE  316 (330)
Q Consensus       238 ~~~~~~fD~vI~N~-dle~a~~~L~~~i~~~~~~~~WvP~sw~~~~~~~~e~~y~h~fd~~ivn~~~~~~~~~l~~~~~~  316 (330)
                            +...+++- .-+   .+|++                |+++|++||++||||||++|||+|||.||++|+++|++
T Consensus       474 ------~~~~~~~~~~~d---~~Lq~----------------i~~eS~~ie~~yghyfD~iIvN~dld~t~~eL~~~iek  528 (542)
T KOG0609|consen  474 ------VMSTIVAKQFTD---EDLQE----------------IIDESARIEQQYGHYFDLIIVNSDLDKTFRELKTAIEK  528 (542)
T ss_pred             ------cccccccccCCH---HHHHH----------------HHHHHHHHHHHhhhheeEEEEcCcHHHHHHHHHHHHHH
Confidence                  11113332 112   12222                35679999999999999999999999999999999999


Q ss_pred             hcCCCceeecccCC
Q psy933          317 LHTTPQWIPVSWVY  330 (330)
Q Consensus       317 ~~~~~qWvp~~w~~  330 (330)
                      |++||||||+||||
T Consensus       529 l~tepqWVPvsWv~  542 (542)
T KOG0609|consen  529 LRTEPQWVPVSWVY  542 (542)
T ss_pred             hccCCceeeeeccC
Confidence            99999999999996



>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG1384|consensus Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>KOG3354|consensus Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>KOG3079|consensus Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>KOG3877|consensus Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
1kgd_A180 Crystal Structure Of The Guanylate Kinase-Like Doma 1e-73
3ney_A197 Crystal Structure Of The Kinase Domain Of Mpp1P55 L 2e-55
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 3e-25
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 4e-25
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-24
1lvg_A198 Crystal Structure Of Mouse Guanylate Kinase In Comp 1e-23
3uat_A296 Guanylate Kinase Domains Of The Maguk Family Scaffo 2e-23
3tvt_A292 Structural Basis For Discs Large Interaction With P 4e-23
4f4j_A202 Conversion Of The Enzyme Guanylate Kinase Into A Mi 2e-19
1gky_A187 Refined Structure Of The Complex Between Guanylate 2e-18
1ex6_A186 Crystal Structure Of Unliganded Form Of Guanylate K 2e-18
2j41_A207 Crystal Structure Of Staphylococcus Aureus Guanylat 6e-12
2qor_A204 Crystal Structure Of Plasmodium Vivax Guanylate Kin 2e-11
1z6g_A218 Crystal Structure Of Guanylate Kinase From Plasmodi 1e-10
3tau_A208 Crystal Structure Of A Putative Guanylate Monophosp 1e-09
1s96_A219 The 2.0 A X-Ray Structure Of Guanylate Kinase From 9e-09
2an9_A207 Crystal Structure Of Oligomeric E.Coli Guanylate Ki 3e-08
3lnc_A231 Crystal Structure Of Guanylate Kinase From Anaplasm 1e-07
1z8f_A228 Guanylate Kinase Double Mutant A58c, T157c From Myc 2e-06
1znw_A207 Crystal Structure Of Unliganded Form Of Mycobacteri 2e-06
1s4q_A228 Crystal Structure Of Guanylate Kinase From Mycobact 2e-06
3tr0_A205 Structure Of Guanylate Kinase (Gmk) From Coxiella B 4e-06
3lh5_A251 Crystal Structure Of The Sh3-Guanylate Kinase Core 5e-05
3kfv_A308 Crystal Structure Of The Sh3-Kinase Fragment Of Tig 8e-05
3tsw_A391 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 8e-05
3shw_A468 Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule 1e-04
>pdb|1KGD|A Chain A, Crystal Structure Of The Guanylate Kinase-Like Domain Of Human Cask Length = 180 Back     alignment and structure

Iteration: 1

Score = 272 bits (696), Expect = 1e-73, Method: Compositional matrix adjust. Identities = 125/176 (71%), Positives = 152/176 (86%) Query: 90 SFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDE 149 S RKTLVLLGAHGVGRRHIKNTLI K PD++AYP+PHTTR P+ DEENG+ YYF+SHD+ Sbjct: 2 SHMRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQ 61 Query: 150 MMSDIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVV 209 MM DI+ N+YLEYG+HEDAMYGTKLETIR+IH++G IAILDVEPQALK+LRT EF+PFVV Sbjct: 62 MMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVV 121 Query: 210 FIAAPQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIE 265 FIAAP + + D SL++L KESDIL+ Y H+FDLT++NN+I+ETI LE+A+E Sbjct: 122 FIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVE 177
>pdb|3NEY|A Chain A, Crystal Structure Of The Kinase Domain Of Mpp1P55 Length = 197 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|1LVG|A Chain A, Crystal Structure Of Mouse Guanylate Kinase In Complex With Gmp And Adp Length = 198 Back     alignment and structure
>pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 Back     alignment and structure
>pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 Back     alignment and structure
>pdb|4F4J|A Chain A, Conversion Of The Enzyme Guanylate Kinase Into A Mitotic Spindle Orienting Protein By A Single Mutation That Inhibits Gmp- Induced Closing Length = 202 Back     alignment and structure
>pdb|1GKY|A Chain A, Refined Structure Of The Complex Between Guanylate Kinase And Its Substrate Gmp At 2.0 Angstroms Resolution Length = 187 Back     alignment and structure
>pdb|1EX6|A Chain A, Crystal Structure Of Unliganded Form Of Guanylate Kinase From Yeast Length = 186 Back     alignment and structure
>pdb|2J41|A Chain A, Crystal Structure Of Staphylococcus Aureus Guanylate Monophosphate Kinase Length = 207 Back     alignment and structure
>pdb|2QOR|A Chain A, Crystal Structure Of Plasmodium Vivax Guanylate Kinase Length = 204 Back     alignment and structure
>pdb|1Z6G|A Chain A, Crystal Structure Of Guanylate Kinase From Plasmodium Falciparum Length = 218 Back     alignment and structure
>pdb|3TAU|A Chain A, Crystal Structure Of A Putative Guanylate Monophosphaste Kinase From Listeria Monocytogenes Egd-E Length = 208 Back     alignment and structure
>pdb|1S96|A Chain A, The 2.0 A X-Ray Structure Of Guanylate Kinase From E.Coli Length = 219 Back     alignment and structure
>pdb|2AN9|A Chain A, Crystal Structure Of Oligomeric E.Coli Guanylate Kinase In Complex With Gdp Length = 207 Back     alignment and structure
>pdb|3LNC|A Chain A, Crystal Structure Of Guanylate Kinase From Anaplasma Phagocytophilum Length = 231 Back     alignment and structure
>pdb|1Z8F|A Chain A, Guanylate Kinase Double Mutant A58c, T157c From Mycobacterium Tuberculosis (Rv1389) Length = 228 Back     alignment and structure
>pdb|1ZNW|A Chain A, Crystal Structure Of Unliganded Form Of Mycobacterium Tuberculosis Guanylate Kinase Length = 207 Back     alignment and structure
>pdb|1S4Q|A Chain A, Crystal Structure Of Guanylate Kinase From Mycobacterium Tuberculosis (Rv1389) Length = 228 Back     alignment and structure
>pdb|3TR0|A Chain A, Structure Of Guanylate Kinase (Gmk) From Coxiella Burnetii Length = 205 Back     alignment and structure
>pdb|3LH5|A Chain A, Crystal Structure Of The Sh3-Guanylate Kinase Core Domain Of Zo-1 Length = 251 Back     alignment and structure
>pdb|3KFV|A Chain A, Crystal Structure Of The Sh3-Kinase Fragment Of Tight Junction Protein 3 (Tjp3) In Apo-Form Length = 308 Back     alignment and structure
>pdb|3TSW|A Chain A, Crystal Structure Of The Pdz3-Sh3-Guk Core Module Of Human Zo-1 Length = 391 Back     alignment and structure
>pdb|3SHW|A Chain A, Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule Complex With Connexin-45 Peptide Length = 468 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
1kjw_A295 Postsynaptic density protein 95; protein-protein i 1e-100
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 1e-95
2xkx_A721 Disks large homolog 4; structural protein, scaffol 6e-87
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 8e-82
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 8e-80
4dey_A337 Voltage-dependent L-type calcium channel subunit; 5e-54
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 3e-48
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-47
3kfv_A308 Tight junction protein ZO-3; structural genomics c 3e-46
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 1e-32
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 1e-31
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 4e-31
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 2e-29
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 2e-25
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 2e-24
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 1e-22
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 3e-22
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 7e-20
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 2e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 6e-04
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
 Score =  295 bits (757), Expect = e-100
 Identities = 72/286 (25%), Positives = 130/286 (45%), Gaps = 32/286 (11%)

Query: 2   FQIISKDDHNWWQARK---DNVAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRK 58
             +I   D  WWQAR+   D+     G IPS    E R                      
Sbjct: 31  LHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREW-------------------- 70

Query: 59  KKLYKDKYLAKHNAVFDQLDLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFP 118
            +L    + +   +   +  +++YE V ++     + +++LG     +    + L+++FP
Sbjct: 71  SRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGP---TKDRANDDLLSEFP 127

Query: 119 DKYAYPVPHTTRSPRSDEENGRAYYFIS-HDEMMSDIAANQYLEYGTHEDAMYGTKLETI 177
           DK+   VPHTTR  R  E +GR Y+F+S  ++M  DI A++++E G +   +YGT ++++
Sbjct: 128 DKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSV 187

Query: 178 RRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSDYDG-----SLEKLAKE 232
           R + ++GK  ILDV   A++ L+     P  +FI    L+N+ + +         K    
Sbjct: 188 REVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDR 247

Query: 233 SDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVSW 278
           +  L+  +   F   V  +  EE    +++ IE+L     W+P   
Sbjct: 248 ATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARE 293


>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Length = 198 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Length = 204 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Length = 218 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Length = 207 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Length = 208 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Length = 207 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Length = 231 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Length = 205 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Length = 219 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 100.0
1kjw_A295 Postsynaptic density protein 95; protein-protein i 100.0
2xkx_A721 Disks large homolog 4; structural protein, scaffol 100.0
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 100.0
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 100.0
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 100.0
3kfv_A308 Tight junction protein ZO-3; structural genomics c 100.0
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 100.0
4dey_A337 Voltage-dependent L-type calcium channel subunit; 100.0
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 100.0
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 100.0
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 100.0
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.98
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.97
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.97
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.93
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.93
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.91
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 99.87
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.74
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 99.42
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 99.42
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 99.4
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 99.38
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 99.34
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.15
3kfv_A308 Tight junction protein ZO-3; structural genomics c 99.12
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 99.08
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 99.01
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.94
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.94
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.93
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 98.93
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 98.92
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 98.91
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 98.9
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 98.87
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 98.86
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.84
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.84
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 98.83
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 98.81
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.77
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.76
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.74
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.73
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 98.73
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.72
1kjw_A295 Postsynaptic density protein 95; protein-protein i 98.7
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 98.7
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 98.68
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.68
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.66
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 98.6
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.6
2xkx_A721 Disks large homolog 4; structural protein, scaffol 98.57
3tlx_A243 Adenylate kinase 2; structural genomics, structura 98.56
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 98.54
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 98.51
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.48
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 98.48
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.47
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 98.46
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 98.46
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 98.4
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.4
2vli_A183 Antibiotic resistance protein; transferase, tunica 98.4
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.4
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.38
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 98.36
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.33
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.31
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 98.31
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.3
1via_A175 Shikimate kinase; structural genomics, transferase 98.25
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 98.25
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 98.24
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 98.18
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 98.18
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.17
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.16
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 98.14
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 98.14
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 98.14
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 98.13
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 98.13
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.12
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 98.11
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 98.1
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 98.09
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 98.09
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 98.08
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 98.06
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 98.06
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.06
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 98.05
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 98.03
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 98.03
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 98.02
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 98.01
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.98
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.97
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.95
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 97.92
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 97.92
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 97.9
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 97.89
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 97.87
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.86
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.85
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.85
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.83
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.83
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.82
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.78
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 97.76
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.76
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 97.72
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.69
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 97.68
3lxw_A247 GTPase IMAP family member 1; immunity, structural 97.66
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 97.65
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 97.54
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.5
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.42
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 97.39
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 97.39
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 97.32
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.28
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 97.25
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 97.24
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 97.24
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.22
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.18
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 97.17
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.15
2wji_A165 Ferrous iron transport protein B homolog; membrane 97.07
4dey_A337 Voltage-dependent L-type calcium channel subunit; 97.06
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 97.03
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 97.02
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 96.99
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 96.98
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.96
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 96.95
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 96.95
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 96.92
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 96.92
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.91
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 96.91
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 96.88
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 96.87
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 96.87
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 96.82
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 96.81
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 96.81
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.79
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 96.79
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 96.78
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.78
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 96.77
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 96.76
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 96.76
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.76
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 96.75
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 96.75
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 96.73
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.73
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.72
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.71
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 96.7
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 96.69
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.68
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.67
2ged_A193 SR-beta, signal recognition particle receptor beta 96.67
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 96.66
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 96.66
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.65
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 96.63
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 96.62
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 96.61
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.6
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 96.6
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 96.6
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.59
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 96.58
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 96.56
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.56
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 96.56
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.55
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 96.55
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 96.53
3t1o_A198 Gliding protein MGLA; G domain containing protein, 96.53
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 96.52
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.52
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 96.51
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 96.51
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 96.51
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.5
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.49
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.47
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.46
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 96.46
2www_A349 Methylmalonic aciduria type A protein, mitochondri 96.46
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 96.46
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.44
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 96.44
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.44
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 96.44
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.43
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 96.42
1nrj_B218 SR-beta, signal recognition particle receptor beta 96.41
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 96.41
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 96.41
3iby_A256 Ferrous iron transport protein B; G protein, G dom 96.4
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.37
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 96.36
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.36
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 96.33
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.33
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 96.33
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 96.32
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 96.31
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.3
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.3
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.3
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.3
1b0u_A262 Histidine permease; ABC transporter, transport pro 96.29
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 96.29
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 96.29
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 96.29
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 96.28
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 96.28
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 96.28
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 96.27
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 96.27
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 96.26
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 96.25
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.24
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 96.24
2eyu_A261 Twitching motility protein PILT; pilus retraction 96.23
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 96.23
1g6h_A257 High-affinity branched-chain amino acid transport 96.23
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 96.23
1ji0_A240 ABC transporter; ATP binding protein, structural g 96.22
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.22
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.21
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 96.21
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.21
2ghi_A260 Transport protein; multidrug resistance protein, M 96.2
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 96.2
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 96.2
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 96.2
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 96.19
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.19
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 96.18
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 96.18
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.18
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 96.16
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.15
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.15
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 96.15
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.15
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 96.14
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 96.13
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.13
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 96.13
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 96.13
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 96.12
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.12
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.11
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 96.11
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 96.1
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.1
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 96.1
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 96.1
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 96.1
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 96.09
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 96.09
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.09
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 96.09
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 96.08
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 96.08
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 96.08
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.08
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 96.08
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 96.07
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.06
3bos_A242 Putative DNA replication factor; P-loop containing 96.06
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 96.06
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 96.05
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 96.05
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.05
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 96.05
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.05
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 96.04
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 96.04
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 96.04
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 96.04
1uti_A58 GRB2-related adaptor protein 2; signaling protein 96.03
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 96.02
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.01
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 96.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.99
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 95.99
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 95.98
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 95.98
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 95.97
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 95.97
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 95.97
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.96
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.95
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 95.95
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 95.95
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 95.94
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 95.94
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.93
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 95.93
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 95.92
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.91
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 95.91
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 95.9
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 95.9
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 95.9
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 95.9
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 95.89
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 95.89
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 95.89
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 95.89
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 95.88
3cnl_A262 YLQF, putative uncharacterized protein; circular p 95.87
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 95.87
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 95.86
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 95.86
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.86
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 95.85
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 95.85
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 95.85
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 95.84
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.84
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.83
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 95.82
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 95.82
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 95.8
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 95.8
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 95.8
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.79
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 95.79
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 95.79
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 95.78
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 95.77
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 95.77
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 95.76
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.76
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 95.75
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 95.74
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 95.74
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 95.74
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.74
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.73
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 95.73
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 95.73
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 95.72
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.72
3llu_A196 RAS-related GTP-binding protein C; structural geno 95.72
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.71
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 95.71
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 95.71
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 95.7
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 95.7
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 95.69
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 95.69
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.69
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 95.68
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.67
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 95.67
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 95.67
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 95.67
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 95.65
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 95.64
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 95.64
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 95.64
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 95.63
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.63
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.62
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 95.62
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 95.61
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 95.6
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 95.59
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.59
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.59
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.59
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 95.58
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 95.57
1awj_A77 ITK; transferase, regulatory intramolecular comple 95.57
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 95.57
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 95.57
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 95.55
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 95.55
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 95.55
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.54
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 95.54
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 95.53
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.53
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 95.53
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 95.53
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 95.5
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 95.5
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 95.5
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.5
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 95.48
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 95.48
2fh5_B214 SR-beta, signal recognition particle receptor beta 95.48
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 95.48
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 95.48
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 95.47
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 95.47
2ewv_A372 Twitching motility protein PILT; pilus retraction 95.47
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.46
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 95.46
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.45
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.45
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 95.45
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 95.44
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 95.44
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 95.43
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 95.42
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 95.41
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 95.41
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 95.41
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 95.41
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 95.4
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 95.4
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 95.4
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 95.4
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 95.38
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 95.38
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 95.37
3kta_A182 Chromosome segregation protein SMC; structural mai 95.37
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.37
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 95.37
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 95.36
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 95.36
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 95.36
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 95.36
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 95.36
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 95.35
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 95.35
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 95.35
1i07_A60 Epidermal growth factor receptor kinase substrate 95.34
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 95.33
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 95.31
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 95.29
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 95.28
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 95.27
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 95.26
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 95.26
2og2_A359 Putative signal recognition particle receptor; nuc 95.26
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 95.26
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 95.25
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 95.25
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.25
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 95.24
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 95.23
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.23
2hf9_A226 Probable hydrogenase nickel incorporation protein 95.23
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.23
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.22
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 95.21
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.21
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 95.2
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 95.19
2j6f_A62 CD2-associated protein; metal-binding, immune resp 95.19
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.19
1u3o_A82 Huntingtin-associated protein-interacting protein; 95.17
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 95.17
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 95.16
1wxq_A 397 GTP-binding protein; structural genomics, riken st 95.14
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 95.14
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 95.14
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 95.13
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 95.13
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 95.13
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 95.12
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 95.12
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 95.11
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 95.09
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 95.09
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 95.08
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.07
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 95.07
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 95.06
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 95.06
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 95.06
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 95.05
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 95.05
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 95.04
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 95.04
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 95.03
2dil_A69 Proline-serine-threonine phosphatase-interacting p 95.03
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 95.02
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-67  Score=496.34  Aligned_cols=245  Identities=28%  Similarity=0.541  Sum_probs=214.0

Q ss_pred             CcEEEeCCCCCceeEEeCC---CCCCceeeCChhHHHHHHhhccccccccccccccccccccccccchhhhccccccCCc
Q psy933            1 MFQIISKDDHNWWQARKDN---VAGSAGLIPSPELQEWRTACSTIDKTKHEQVNCSIFGRKKKLYKDKYLAKHNAVFDQL   77 (330)
Q Consensus         1 iL~v~~~~D~~WWQA~~~~---~~~~~GlIPS~~~~e~r~~~~~~~~~~~~~~~~~~~~rk~k~~~~~~~~~~~~~~~~~   77 (330)
                      ||||+|++|++|||||+++   .+..+|||||+.++|+|...+.                  +           ...+.+
T Consensus        34 iL~V~~~~d~~wWqA~~v~~~~~~~~~GlIPS~~~~e~~~~~~~------------------~-----------~~~~~~   84 (292)
T 3tvt_A           34 ILHVTNASDDEWWQARRVLGDNEDEQIGIVPSKRRWERKMRARD------------------R-----------SVKSEE   84 (292)
T ss_dssp             EEEEEECCSSSEEEECCCCC--------EEECHHHHHHHHHC--------------------------------------
T ss_pred             EEEEeecCCCCeEEEEEeCCCCCccceeEEeChHHHHHHHHHhh------------------c-----------cccccc
Confidence            7999999999999999963   3466999999999998753210                  0           011234


Q ss_pred             cccCceeeecccCCCCCEEEEEcCCCccHHHHHHHHHhhCCCCccccccccccCCCCcccCCeeEEEe-cccchhhHHhc
Q psy933           78 DLVTYEEVVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFI-SHDEMMSDIAA  156 (330)
Q Consensus        78 ~~~~Ye~V~~~~~~~~r~ivLvGpsGvGKstL~~~L~~~~p~~f~~~v~~TTR~pr~~E~~G~dy~fv-s~~~f~~~i~~  156 (330)
                      ++++||+|++++++.+|||||+||+   |+||+++|++.+|+.|..+|+||||+||+||+||+||||| ++++|++++++
T Consensus        85 ~~~~YE~V~~~~~~~~RpvVl~Gp~---K~tl~~~Ll~~~p~~f~~sVs~TTR~pR~gE~dG~dY~Fv~s~e~fe~~i~~  161 (292)
T 3tvt_A           85 NVLSYEAVQRLSINYTRPVIILGPL---KDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQN  161 (292)
T ss_dssp             -CCCEEEEEEEECSSCCCEEEESTT---HHHHHHHHHHHCTTTEECCCCEECSCCCTTCCBTTTBEECSCHHHHHHHHHT
T ss_pred             cccchheEEeccCCCCCeEEEeCCC---HHHHHHHHHHhChhhccccccCCccCCcCCccCCccccccCCHHHHHHHHhc
Confidence            6789999999999999999999995   9999999999999999999999999999999999999999 88999999999


Q ss_pred             cceeeEEeecCccccccHHHHHHHHHhCCeEEEEeCHHHHHHHHhcCCCCEEEEEccCccccccC-----chHHHHHHHH
Q psy933          157 NQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLSD-----YDGSLEKLAK  231 (330)
Q Consensus       157 ~~fle~~~~~g~~YGts~~~i~~v~~~gk~~vldv~~~~v~~L~~~~~~p~vIfI~pps~~~l~~-----~~e~~~rl~~  231 (330)
                      |.||||++++||+|||++++|++++++|++||||++++|+++|+...++|++|||+|||++.|++     .+++.+++.+
T Consensus       162 ~~flE~a~~~gn~YGT~~~~V~~~~~~gk~viLdid~qg~~~lk~~~~~pi~IFI~PpS~e~L~~r~~~r~~e~~~~~~~  241 (292)
T 3tvt_A          162 HLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVMEMNRRMTEEQAKKTYE  241 (292)
T ss_dssp             TCEEEEEEETTEEEEEEHHHHHHHHHHTCEEEECCCTHHHHHHHHTTCCCEEEEECCSCHHHHHHTCTTSCTTHHHHHHH
T ss_pred             CceEEEEEEccceeEEehHHHHHHHHcCCcEEEeccchhhhhcccccccceEEEEECCCHHHHHHHHhCCCchhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999998752     3455666776


Q ss_pred             HHHHHHhhccccceEEEecCCHHHHHHHHHHHHHHhcCCCcccccc
Q psy933          232 ESDILKSAYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVS  277 (330)
Q Consensus       232 ~~~~ie~~~~~~fD~vI~N~dle~a~~~L~~~i~~~~~~~~WvP~s  277 (330)
                      .+.+++++|+|+||+||+|||+++|+++|+++|..++.+|+|||+.
T Consensus       242 r~~k~e~e~~~~fD~vIvNddle~a~~~l~~iI~~e~~~~~WVP~~  287 (292)
T 3tvt_A          242 RAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIWVPSK  287 (292)
T ss_dssp             HHHHHHHHHTTTCSEEECCSSHHHHHHHHHHHHHHHTCSEEEEEC-
T ss_pred             HHHHHHHhhhhhCCEEEECcCHHHHHHHHHHHHHHhhCCCeEecCc
Confidence            7777888899999999999999999999999999999999999975



>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 330
d1kgda_178 c.37.1.1 (A:) Guanylate kinase-like domain of Cask 6e-35
d1kjwa2199 c.37.1.1 (A:526-724) Guanylate kinase-like domain 3e-29
d1lvga_190 c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculu 3e-23
d1gkya_186 c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Sac 2e-20
d1s96a_205 c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ 8e-20
d1znwa1182 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu 7e-13
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 4e-08
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 2e-06
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 2e-06
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 4e-05
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 0.001
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Cask
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  123 bits (310), Expect = 6e-35
 Identities = 124/173 (71%), Positives = 151/173 (87%)

Query: 93  RKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFISHDEMMS 152
           RKTLVLLGAHGVGRRHIKNTLI K PD++AYP+PHTTR P+ DEENG+ YYF+SHD+MM 
Sbjct: 3   RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQ 62

Query: 153 DIAANQYLEYGTHEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIA 212
           DI+ N+YLEYG+HEDAMYGTKLETIR+IH++G IAILDVEPQALK+LRT EF+PFVVFIA
Sbjct: 63  DISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIA 122

Query: 213 APQLQNLSDYDGSLEKLAKESDILKSAYEHFFDLTVVNNDIEETIGILEKAIE 265
           AP +    + D SL++L KESDIL+  Y H+FDLT++NN+I+ETI  LE+A+E
Sbjct: 123 APTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVE 175


>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 199 Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 186 Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 100.0
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 100.0
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 100.0
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 100.0
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 100.0
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 100.0
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 99.01
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 98.89
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 98.84
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.83
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.8
d1t0hb_219 Guanylate kinase-like domain of the L-type calcium 98.78
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.73
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.72
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.72
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.68
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.66
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.64
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 98.6
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.59
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.58
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 98.48
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.44
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.42
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.41
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.38
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.37
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 98.37
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.34
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.27
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.25
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 98.25
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.24
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 98.23
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.23
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.21
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.17
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.11
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.1
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 98.04
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.98
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 97.97
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.95
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.91
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.87
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 97.86
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.86
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.83
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.81
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 97.78
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.76
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.67
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.65
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.62
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.61
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.53
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.5
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.49
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 97.47
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 97.43
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.4
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.39
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.37
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.36
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 97.34
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.33
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.31
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.27
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.25
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.24
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.19
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.18
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 97.17
d1nrjb_209 Signal recognition particle receptor beta-subunit 97.17
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.16
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.15
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.14
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.1
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 97.05
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.0
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.99
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.96
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 96.93
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.92
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.92
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.91
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.89
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.88
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.88
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.86
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.86
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 96.85
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.83
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 96.81
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.78
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.77
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.76
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.72
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.7
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.7
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.68
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.68
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.66
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.66
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.65
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.65
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.64
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.62
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 96.6
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.54
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.52
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.52
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.5
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.45
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 96.44
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.42
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 96.4
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.38
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.38
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.38
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.38
d1vmaa2213 GTPase domain of the signal recognition particle r 96.34
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.33
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.33
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.32
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 96.32
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 96.3
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.3
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.29
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 96.29
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.28
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 96.27
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 96.27
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 96.26
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.25
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.25
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.23
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.22
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.22
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.2
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 96.17
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.14
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.09
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.07
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 96.06
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 95.98
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.98
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 95.96
d1okkd2207 GTPase domain of the signal recognition particle r 95.93
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.92
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.92
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 95.92
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 95.9
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 95.9
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.87
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 95.84
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 95.83
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.82
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.81
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.8
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 95.8
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 95.78
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 95.75
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 95.74
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 95.73
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.72
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.69
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.69
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.69
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.67
d2qy9a2211 GTPase domain of the signal recognition particle r 95.65
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.65
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 95.65
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.62
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.61
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.6
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.6
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 95.57
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 95.56
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 95.55
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.55
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 95.54
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.53
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.52
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 95.51
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 95.51
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.5
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 95.46
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 95.42
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.41
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 95.39
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 95.3
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.29
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.25
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 95.22
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.22
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.21
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.19
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.18
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.14
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 95.11
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.11
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.1
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.09
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 95.07
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 95.06
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.05
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.04
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 95.04
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.02
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 95.02
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.99
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.94
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 94.89
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 94.84
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 94.84
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 94.83
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 94.8
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.74
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.72
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 94.66
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.57
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.54
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 94.52
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.45
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 94.44
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 94.44
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.43
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 94.41
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 94.39
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.33
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 94.31
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 94.29
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 94.24
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.23
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.19
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.07
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 94.03
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.77
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 93.74
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 93.74
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 93.69
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 93.62
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 93.56
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.5
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.44
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 93.43
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 93.42
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 93.41
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 93.04
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.03
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 93.02
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.89
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 92.89
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.86
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 92.84
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.76
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 92.64
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.6
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 92.56
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.51
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.49
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 92.45
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 92.44
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 92.35
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 92.06
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.89
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 91.83
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 91.7
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 91.61
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 91.46
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.44
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 91.39
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 91.35
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 91.1
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 90.85
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 90.71
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.54
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 90.3
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 90.23
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 90.22
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 90.04
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 90.02
d1tuea_205 Replication protein E1 helicase domain {Human papi 89.11
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 88.37
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 88.29
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 88.26
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 87.65
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 87.21
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 87.04
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.63
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 86.23
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 85.82
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 85.36
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 85.0
d1xpua3289 Transcription termination factor Rho, ATPase domai 84.79
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 84.6
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.46
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 84.3
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 84.16
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 83.26
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 81.78
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 81.04
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 80.81
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 80.14
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 80.12
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Psd-95
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=3.1e-49  Score=351.64  Aligned_cols=190  Identities=29%  Similarity=0.569  Sum_probs=176.2

Q ss_pred             eecccCCCCCEEEEEcCCCccHHHHHHHHHhhCCCCccccccccccCCCCcccCCeeEEEe-cccchhhHHhccceeeEE
Q psy933           85 VVKLPSFKRKTLVLLGAHGVGRRHIKNTLINKFPDKYAYPVPHTTRSPRSDEENGRAYYFI-SHDEMMSDIAANQYLEYG  163 (330)
Q Consensus        85 V~~~~~~~~r~ivLvGpsGvGKstL~~~L~~~~p~~f~~~v~~TTR~pr~~E~~G~dy~fv-s~~~f~~~i~~~~fle~~  163 (330)
                      |+++....+|||||+||+   |+|+.++|++.+|+.|..+++||||+||+||.+|+||||| ++++|++++..|.|+||+
T Consensus         1 v~~~~~~~~Rpivi~Gp~---K~ti~~~L~~~~p~~f~~~is~TTR~~R~~E~dG~dY~Fv~~~e~F~~~i~~~~fiE~~   77 (199)
T d1kjwa2           1 VTQMEVHYARPIIILGPT---KDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAG   77 (199)
T ss_dssp             EEEEECCSCCCEEEESTT---HHHHHHHHHHHCTTTEECCCCEECSCCCTTCCBTTTBEECSCHHHHHHHHHTTCEEEEE
T ss_pred             CccccCCCCCCEEEECcC---HHHHHHHHHHhCccceeecccccccCCCCCCCCCcccchhhhHHHHHHHHhhccceeee
Confidence            566766678999999994   9999999999999999999999999999999999999999 678899999999999999


Q ss_pred             eecCccccccHHHHHHHHHhCCeEEEEeCHHHHHHHHhcCCCCEEEEEccCcccccc-----CchHHHHHHHHHHHHHHh
Q psy933          164 THEDAMYGTKLETIRRIHQEGKIAILDVEPQALKILRTGEFSPFVVFIAAPQLQNLS-----DYDGSLEKLAKESDILKS  238 (330)
Q Consensus       164 ~~~g~~YGts~~~i~~v~~~gk~~vldv~~~~v~~L~~~~~~p~vIfI~pps~~~l~-----~~~e~~~rl~~~~~~ie~  238 (330)
                      +++|++|||+.++|+.++++|++||++++++|+++|+..++.|++|||.|||.+.++     .+++++++..+.+.++++
T Consensus        78 ~~~g~~YGt~~~~i~~~~~~gk~~lldid~~g~~~lk~~~~~~i~IfI~pps~e~l~~l~kr~~~~~i~~r~~~~~~~e~  157 (199)
T d1kjwa2          78 QYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQ  157 (199)
T ss_dssp             EETTEEEEEEHHHHHHHHHTTCEEEECCCTTHHHHHHHTTCCCEEEEECCSSHHHHHHHCTTSCHHHHHHHHHHHHHHHH
T ss_pred             eecCCccceeeeEEEehhcCCCcccccccchHHhhhhhhccceeEEeeccccHHHHHhhhccccHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999988664     356677776666777888


Q ss_pred             hccccceEEEecCCHHHHHHHHHHHHHHhcCCCcccccc
Q psy933          239 AYEHFFDLTVVNNDIEETIGILEKAIEELHTTPQWIPVS  277 (330)
Q Consensus       239 ~~~~~fD~vI~N~dle~a~~~L~~~i~~~~~~~~WvP~s  277 (330)
                      .+.++||++|+|+|+++|+++|.++|++++++|+|||+.
T Consensus       158 ~~~~~fd~vI~Nddle~a~~~l~~iI~~~~~~~~WvP~~  196 (199)
T d1kjwa2         158 EFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPAR  196 (199)
T ss_dssp             HHGGGCSEEECCSSHHHHHHHHHHHHHHHSCSEEEEECS
T ss_pred             HhhccCCEEEECcCHHHHHHHHHHHHHHhcCCCeeecCc
Confidence            899999999999999999999999999999999999974



>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure