Diaphorina citri psyllid: psy9354


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MSSGMSGRYVVASPVEYSPEPLPATVKYAKKRSSAGLGDEGGAYKRSREKASKGLRHFSMKVCEKVRRKGVTTYNEVADELVQEFSEDHNTASSEQEKKEIKWLGLPTNSLQESLNLNKERKQLIQRINQKTRHLHDLLLQQISLKKLIQKNIDSEKIHGEPAPSSAIQLPFLIVSTDKKTVIDCSMSNDKTEYLFVFDNKFEIHDDIEILKRMGLGMGLDKGEWTEEDLQEAKRLVAPCMEKYVNQIAYNDGLLAEEDDSMLLDDESGSFDSSQITIETVMPEEVMSVSGSEGESDLSSDIDHVEVH
cccccccccccccccccccccccccHHHHHcccccccccccccccccHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccHHHHccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEECccccEEEEEEcccccEEEEEccccEEEEccHHHHHHHccccccccccccHHHHHHHHHcccccHHHHHHHHHcccccccccccccccccccccccccccCCcccccccccccccccccccccccccccccc
*********************************************************FSMKVCEKVRRKGVTTYNEVADELVQEF***************IKWLGLPTNSLQ***********LIQRINQKTRHLHDLLLQQISLKKLIQKNI*************AIQLPFLIVSTDKKTVIDCSMSNDKTEYLFVFDNKFEIHDDIEILKRMGLGMGLDKGEWTEEDLQEAKRLVAPCMEKYVNQIAYN*********************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSGMSGRYVVASPVEYSPEPLPATVKYAKKRSSAGLGDEGGAYKRSREKASKGLRHFSMKVCEKVRRKGVTTYNEVADELVQEFSEDHNTASSEQEKKEIKWLGLPTNSLQESLNLNKERKQLIQRINQKTRHLHDLLLQQISLKKLIQKNIDSEKIHGEPAPSSAIQLPFLIVSTDKKTVIDCSMSNDKTEYLFVFDNKFEIHDDIEILKRMGLGMGLDKGEWTEEDLQEAKRLVAPCMEKYVNQIAYNDGLLAEEDDSMLLDDESGSFDSSQITIETVMPEEVMSVSGSEGESDLSSDIDHVEVH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor Dp-1 Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DP2/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F-1/DP complex appears to mediate both cell proliferation and apoptosis.confidentQ08639
Transcription factor Dp-1 Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DP2/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F-1/DP complex appears to mediate both cell proliferation and apoptosis.confidentQ17QZ4
Transcription factor Dp-1 Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DP2/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F-1/DP complex appears to mediate both cell proliferation and apoptosis.confidentQ14186

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0051329 [BP]interphase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AZE, chain A
Confidence level:very confident
Coverage over the Query: 110-254
View the alignment between query and template
View the model in PyMOL
Template: 1CF7, chain B
Confidence level:very confident
Coverage over the Query: 52-107
View the alignment between query and template
View the model in PyMOL