Diaphorina citri psyllid: psy9363


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MDSRVSNAGKTHDEIEQAVPFIEDLDLSRNLLASWFAVGEITCQLKHLRHLNLRIRLKSSSAPAHSYLAEVVFFVHLGRTLCDEDFVKEGSLLHYLPKLSSLRFTKNPILAEERVVSSREKTIARLGGLKLLNGSAIERQERQGSEYDYIKEFGAVWLDEKRRAEFLEANPRVGDNYFQVMEDDIGLRVCDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHSTTSGSFMRRDKLNFGSSFMEALHRKYVETDNELTVRENVEEVKASINAPFLELVGFDQVHEEQNTNKLPIPNDTSGVMEQIFPQGHIHTLTLGNMGYIWADILKLLANFPVTCLKLPSNRITTLDSVPGMFSSLEELYLQENNIVDWGEVNALGSLPNLKYLNLASTNLRNIKLNKEGHYRP
ccccccccccccHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccccccccccccEEEEccccccccccccccccccccccccccEEEECccccccccccccccHHHHHHccccccccccccccccccccccHHHHcccccHHHHHHHHHHHcccccccccccEEECccccccccccccccEEEEEEEECcccccEEEEEEEccccccccccCEccEEEEEEcccccCEEECcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEccccHHHHHccccccccccccccccccccccccEEEECcccccccHHHHHHHHccccccEEEccccccccccccccccccccEEEccccccccHHHHHHHcccccccEEEccccccccccccccccccc
************DEIEQAVPFIEDLDLSRNLLASWFAVGEITCQLKHLRHLNLRIRLKSSSAPAHSYLAEVVFFVHLGRTLCDEDFVKEGSLLHYLPKLSSLRFTKNPILAEERVVSSREKTIARLGGLKLLNGSAIERQERQGSEYDYIKEFGAVWLDEKRRAEFLEANPRVGDNYFQVMEDDIGLRVCDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHSTTSGSFMRRDKLNFGSSFMEALHRKYVETDNELTVRENVEEVKASINAPFLELVGFDQVHEEQNTNKLPIPNDTSGVMEQIFPQGHIHTLTLGNMGYIWADILKLLANFPVTCLKLPSNRITTLDSVPGMFSSLEELYLQENNIVDWGEVNALGSLPNLKYLNLASTNLRNIKL********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSRVSNAGKTHDEIEQAVPFIEDLDLSRNLLASWFAVGEITCQLKHLRHLNLRIRLKSSSAPAHSYLAEVVFFVHLGRTLCDEDFVKEGSLLHYLPKLSSLRFTKNPILAEERVVSSREKTIARLGGLKLLNGSAIERQERQGSEYDYIKEFGAVWLDEKRRAEFLEANPRVGDNYFQVMEDDIGLRVCDSEGHRGTIRYVGSVEGTQGVWYGIDWDSETRGKHDGSHNGVKYFWTHSTTSGSFMRRDKLNFGSSFMEALHRKYVETDNELTVRENVEEVKASINAPFLELVGFDQVHEEQNTNKLPIPNDTSGVMEQIFPQGHIHTLTLGNMGYIWADILKLLANFPVTCLKLPSNRITTLDSVPGMFSSLEELYLQENNIVDWGEVNALGSLPNLKYLNLASTNLRNIKLNKEGHYRP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 16-156,171-173,187-226,250-257,275-412
View the alignment between query and template
View the model in PyMOL
Template: 4FMZ, chain A
Confidence level:very confident
Coverage over the Query: 31-157,172,186-226,250-259,274-406
View the alignment between query and template
View the model in PyMOL
Template: 2ID5, chain A
Confidence level:very confident
Coverage over the Query: 20-142,156-157,176-226,250-254,273-409
View the alignment between query and template
View the model in PyMOL
Template: 3BZ5, chain A
Confidence level:very confident
Coverage over the Query: 12-156,172-262,274-415
View the alignment between query and template
View the model in PyMOL
Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 11-155,171-264,277-413
View the alignment between query and template
View the model in PyMOL